Property Summary

NCBI Gene PubMed Count 102
Grant Count 7
R01 Count 5
Funding $1,041,329.29
PubMed Score 73.60
PubTator Score 255.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (58)

PMID Text
27273957 Progressive loss of e-cadherin/alpha-catenin expression is associated with an aggressive phenotype (low differentiation, increased metastatic activity/advanced stage) in thyroid carcinomas.
26691986 study identifies CTNNA1 gene variants as a cause of macular dystrophy, indicates that CTNNA1 is involved in maintaining RPE integrity
26261181 Actin-dependent CTNNA1 clustering is a unique molecular mechanism mediating both integrity and reassembly of the cell-cell adhesive interface formed through weak cis- and trans-intercadherin interactions.
26192076 This work identified alpha-catenin as another molecule in addition to E- and P-cadherin that were targeted to inactivate homotypic cell-in-cell structures formation in human tumor cells.
25894537 The results demonstrate a Fas-mediated apoptotic signaling pathway that is enhanced by the age-dependent loss of alpha(E)-catenin in renal tubule epithelial cells.
25544608 alpha-catenin is a reversible, stretch-activatable sensor that mechanically links cadherin complexes and actin and is an indispensable player in cadherin-specific mechanotransduction at intercellular junctions.
25483184 alpha-catenin functions as a tumor suppressor in E-cadherin-negative basal like breast cancer cells by inhibiting NF-kappaB signaling.
25153418 CTNNA1 hypermethylation was detected in three out of four with isolated del(5q), one with trisomy 11, one with monosomy 7, one out of four with del(20q), and one out of seven with complex abnormalities, but in none with trisomy 8.
24685333 CTNNA1 methylation is a recurrent event but has no influence on prognosis in acute myeloid leukemia
24509793 CTNNA1 expression is specifically downregulated in basal-like breast cancer subtype, correlates with clinical outcome and inversely correlates with TNF and RELB expression.
More...

AA Sequence

MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATE      1 - 70
NFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLI     71 - 140
LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAA    141 - 210
RGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAY    211 - 280
ALNNFDKQIIVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSE    281 - 350
YMGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA    351 - 420
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQ    421 - 490
WEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEM    491 - 560
DNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVL    561 - 630
MIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDA    631 - 700
EVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDS    701 - 770
ACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS    771 - 840
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI        841 - 906
//

Text Mined References (123)

PMID Year Title
27273957 E-cadherin/?-catenin deregulated co-expression in thyroid carcinoma based on tissue microarray digital image analysis.
26691986 2016 Mutations in CTNNA1 cause butterfly-shaped pigment dystrophy and perturbed retinal pigment epithelium integrity.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26261181 2015 ?-Catenin-mediated cadherin clustering couples cadherin and actin dynamics.
26192076 2015 Impaired formation of homotypic cell-in-cell structures in human tumor cells lacking alpha-catenin expression.
25894537 2015 Loss of ?(E)-catenin promotes Fas mediated apoptosis in tubular epithelial cells.
25544608 2015 Dynamic visualization of ?-catenin reveals rapid, reversible conformation switching between tension states.
25483184 2014 ?-catenin. A tumor suppressor beyond adherens junctions.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...