Property Summary

NCBI Gene PubMed Count 9
Grant Count 24
R01 Count 17
Funding $3,592,503.32
PubMed Score 280.90
PubTator Score 101.42

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
24530203 CA5A alterations cause hyperammonemia in early childhood that result in mitochondrial carbonic anhydrase VA deficiency
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of carbonic anhydrase VA, mitochondrial (CA5A) in U-937 macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
17174092 activators enhanced kcat, with no effect on KM, favoring the RDS in the catalytic cycle; the activation pattern of the two mitochondrial isoforms is very different from each other and as compared to those of the cytosolic isoforms hCA I and II.

AA Sequence

MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQ      1 - 70
WRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGG     71 - 140
SEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARA    141 - 210
AMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNN    211 - 280
YRPLQPLMNRKVWASFQATNEGTRS                                                 281 - 305
//

Text Mined References (17)

PMID Year Title
24530203 2014 Mitochondrial carbonic anhydrase VA deficiency resulting from CA5A alterations presents with hyperammonemia in early childhood.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
18618712 2009 Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
17314045 2007 Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.
17174092 2007 Carbonic anhydrase activators: an activation study of the human mitochondrial isoforms VA and VB with amino acids and amines.
17127057 2007 Carbonic anhydrase activators: L-Adrenaline plugs the active site entrance of isozyme II, activating better isoforms I, IV, VA, VII, and XIV.
16807956 2006 Carbonic anhydrase activators. Activation of isozymes I, II, IV, VA, VII, and XIV with l- and d-histidine and crystallographic analysis of their adducts with isoform II: engineering proton-transfer processes within the active site of an enzyme.
More...