Property Summary

Ligand Count 139
NCBI Gene PubMed Count 10
PubMed Score 304.13
PubTator Score 101.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35218 B2RPF2
Symbols CA5
CAV
CAVA
CA5AD
GS1-21A4.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQ      1 - 70
WRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGG     71 - 140
SEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARA    141 - 210
AMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNN    211 - 280
YRPLQPLMNRKVWASFQATNEGTRS                                                 281 - 305
//

Text Mined References (18)

PMID Year Title