Property Summary

NCBI Gene PubMed Count 81
PubMed Score 180.62
PubTator Score 114.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
interstitial cystitis 1.100 2.4e-04
intraductal papillary-mucinous adenoma (... -1.100 4.9e-04
intraductal papillary-mucinous carcinoma... -1.100 8.4e-05
intraductal papillary-mucinous neoplasm ... -1.200 1.4e-03
invasive ductal carcinoma -1.100 1.5e-02
lung adenocarcinoma -1.032 2.8e-11
lung cancer -1.200 4.8e-03
non-small cell lung cancer -1.314 2.2e-18
osteosarcoma -1.142 4.4e-02
psoriasis 1.100 1.2e-03

Gene RIF (66)

AA Sequence

MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAF      1 - 70
PISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVA     71 - 140
EDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFI    141 - 210
IFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT    211 - 280
YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV                     281 - 333
//

Text Mined References (82)

PMID Year Title