Property Summary

NCBI Gene PubMed Count 78
Grant Count 71
R01 Count 64
Funding $5,859,733.35
PubMed Score 169.16
PubTator Score 114.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (63)

PMID Text
26656196 Our findings suggest that the Cx37 C1019T variation may contribute to the risk of PCOS in the South Indian women.
26588185 The protective effect of the T allele of the Cx37 gene might be strongly modified by smoking; in women, this effect could be mediated through stem cells.
24937033 Review/Meta-analysis: Cx37 C1019T was a risk factor for myocardial infarction and a protective factor for coronary artery disease.
24773516 three variants in PNPLA3 gene may be a genetic risk factor for NASH
24685073 The C allele in the CX37 gene might be associated with the susceptibility to EH in population of Wuxi, China.
24333099 the C1019T polymorphism may be a moderate risk factor for MI and that DM was likely a potential source of between-study heterogeneity. [META-ANALYSIS]
24261225 Determination of Cx37 C1019T and eNOS G894T polymorphisms may be used to detect a genetic predisposition to the development of myocardial infarction in patients with hemodynamically insignificant atherosclerosis and in apparently healthy individuals.
23926016 1019C/T polymorphism in the CX37 gene is associated with susceptibility to coronary artery disease as well as restenosis after coronary stenting in male patients.
23724624 It is suggested that the polymorphism in the Cx37 gene (but not Cx40 gene) potentially plays a significant role in the manifestation of AMI disease in Iranian population
22901223 C1019T polymorphism in the connexin 37 gene is associated with Helicobacter pylori infection and gastric cancer.
More...

AA Sequence

MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAF      1 - 70
PISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVA     71 - 140
EDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFI    141 - 210
IFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT    211 - 280
YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV                     281 - 333
//

Text Mined References (79)

PMID Year Title
26656196 2016 Analysis of Connexin37 gene C1019T polymorphism and PCOS susceptibility in South Indian population: case-control study.
26588185 2016 Smoking impairs and circulating stem cells favour the protective effect of the T allele of the connexin37 gene in ischemic heart disease--A multinational study.
24937033 2014 Association of Connexin37 C1019T with myocardial infarction and coronary artery disease: a meta-analysis.
24773516 2014 Cx37 C1019T polymorphism may contribute to the pathogenesis of coronary heart disease.
24685073 2014 Association between 1019C/T polymorphism in the connexin 37 gene and essential hypertension.
24333099 2014 The Connexin37 gene C1019T polymorphism and risk of coronary artery disease: a meta-analysis.
24261225 2013 [Endothelial NO synthase and connexin 37 gene polymorphisms as a risk factor for myocardial infarction in subjects without a history of coronary artery disease].
23926016 2013 [Association between 1019C/T polymorphism of Connexin 37 gene and restenosis after coronary stenting].
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23724624 2013 Mutations of the connexin 37 and 40 gap-junction genes in patients with acute myocardial infarction.
More...