Property Summary

NCBI Gene PubMed Count 28
Grant Count 61
R01 Count 31
Funding $6,407,803.55
PubMed Score 74.81
PubTator Score 13.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Amyotrophic Lateral Sclerosis 1.247 0.000
ovarian cancer -2.100 0.000

Synonym

Accession P35125 Q15634 Q86WP6 Q8IWT4
Symbols HRP1
TRE2
TRE17
Tre-2
TRESMCR
USP6-short

Gene

Gene RIF (16)

PMID Text
25179595 TRE17/USP6 regulates ubiquitylation and trafficking of cargo proteins that enter cells by clathrin-independent endocytosis
24742829 8 of the 9 giant cell reparative granulomas from hands and feet showed rearrangements of the USP6 gene compared with none of 8 gnathic lesions
23769422 we discuss the clinicopathologic features, molecular pathology, and pathogenesis of ABC and nodular fasciitis in relation to USP6
23748914 identification of a USP6 gene rearrangement is helpful in making a diagnosis of nodular fasciitis.
22188517 manipulating USP6 expression levels alters the ability of cells to migrate and to divide. Cell proliferation and progression through cytokinesis depend on USP6 expression
20418905 TRE17 is sufficient to initiate tumorigenesis, identify MMPs as novel TRE17 effectors that likely contribute to aneurysmal bone cyst pathogenesis.
18265974 No USP6 rearrangements were found in cherubism or brown tumors. USP6 rearrangements were identified in 2 patients with myositis ossificans.
18187620 Knockdown of ubiquitin specific peptidase 6 (USP6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17701273 The lack of secondary structure of the region flanking the TBC domain in TRE2 may explain why this region plays a role in the lack of GAP activity, even when a potentially functional TBC domain is present.
16127172 Ca2+/CaM has a role in regulating ubiquitination through direct interaction with TRE17
More...

AA Sequence

MDMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRRE      1 - 70
MTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIKLKNPGRYQIMKERGKRSSEH     71 - 140
IHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSHITALFLLYLPEEDAFWALV    141 - 210
QLLASERHSLPGFHSPNGGTVQGLQDQQEHVVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGL    211 - 280
TLRLWDVYLVEGEQVLMPITSIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLT    281 - 350
RKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAV    351 - 420
REDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLAT    421 - 490
CWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYF    491 - 560
ISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSVAPLKLRRTIAKYAPKFDGFQQQDSQELLAF    561 - 630
LLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVR    631 - 700
FDPFNFLSLPLPMDSYMDLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDS    701 - 770
NIKNFPQDNQKVQLSVSGFLCAFEIPVPSSPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGM    771 - 840
PNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFGMPLIVPCTVH    841 - 910
TRKKDLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQKDGNSCAWCPQYRFCRGCKID    911 - 980
CGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESVEQSRRAQAEPINLDSCLRAFTSEEELGESE    981 - 1050
MYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQFVNDQWIKSQKIVRFLRESFDPSAFLVPRDPALCQH   1051 - 1120
KPLTPQGDELSKPRILAREVKKVDAQSSAGKEDMLLSKSPSSLSANISSSPKGSPSSSRKSGTSCPSSKN   1121 - 1190
SSPNSSPRTLGRSKGRLRLPQIGSKNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQ   1191 - 1260
DHEVALANGFLYEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYI   1261 - 1330
TYAKNPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSTDEDSESDYE   1331 - 1400
KYSMLQ                                                                   1401 - 1406
//

Text Mined References (29)

PMID Year Title
25179595 2014 TRE17/USP6 regulates ubiquitylation and trafficking of cargo proteins that enter cells by clathrin-independent endocytosis.
24742829 2014 USP6 gene rearrangements occur preferentially in giant cell reparative granulomas of the hands and feet but not in gnathic location.
23769422 2014 USP6-induced neoplasms: the biologic spectrum of aneurysmal bone cyst and nodular fasciitis.
23748914 2013 Detection of USP6 gene rearrangement in nodular fasciitis: an important diagnostic tool.
22188517 2012 The oncogenic TBC domain protein USP6/TRE17 regulates cell migration and cytokinesis.
20418905 2010 TRE17/USP6 oncogene translocated in aneurysmal bone cyst induces matrix metalloproteinase production via activation of NF-kappaB.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18265974 2008 Frequency of USP6 rearrangements in myositis ossificans, brown tumor, and cherubism: molecular cytogenetic evidence that a subset of "myositis ossificans-like lesions" are the early phases in the formation of soft-tissue aneurysmal bone cyst.
17701273 2007 Mutational analysis of the TRE2 oncogene encoding an inactive RabGAP.
More...