Property Summary

NCBI Gene PubMed Count 31
PubMed Score 89.63
PubTator Score 143.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.29110424253138E-18
lung carcinoma 2844 3.91731377287739E-18
lung cancer 4473 5.23833070271317E-7
psoriasis 6685 7.77321255500975E-6
interstitial cystitis 2299 2.54307021873854E-4
osteosarcoma 7933 9.66768255152645E-4
ulcerative colitis 2087 0.0021172598842238
invasive ductal carcinoma 2950 0.0029775468524419
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00338091537227027
Breast cancer 3099 0.00435977740937583
glioblastoma 5572 0.00919136460684927
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0269211624244223
chronic rhinosinusitis 512 0.0300077215465584
Disease Target Count Z-score Confidence
Complex partial epilepsy 3 3.372 1.7
Spinal muscular atrophy 24 3.077 1.5

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -2.600 0.000
osteosarcoma 1.853 0.001
glioblastoma -1.200 0.009
non-small cell lung cancer 2.269 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.003
intraductal papillary-mucinous carcinoma... -1.800 0.027
lung cancer 3.200 0.000
interstitial cystitis -1.600 0.000
lung carcinoma 2.900 0.000
invasive ductal carcinoma 1.700 0.003
ulcerative colitis -1.600 0.002
Breast cancer 1.100 0.004
chronic rhinosinusitis -1.080 0.030

Synonym

Accession P35080 B2R4C8 D3DNI4 Q4VBQ4 Q8WVF9 Q9HBK2
Symbols PFL
D3S1319E

Gene

PDB

1D1J  

  Ortholog (10)

Gene RIF (8)

PMID Text
26764407 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ alpha-1) and profilin 2.
26354229 Pfn2 suppresses the recruitment of HDAC1 to Smad2 and Smad3 promoters, increasing their expression, and, in turn, enhancing TGFB1 induced epithelial-mesenchymal transformation and VEGF and CTGF production.
25964982 Therefore, this study indicates that profilin 2 affects the metastatic potential and stemness of colorectal CSCs by regulating EMT- and stemness-related proteins.
23898208 HIV-1 Tat downregulates the expression of profilin 2 (PFN2) in human primary T cells
23827010 effects of profilin-1 and profilin-2, the two major isoforms of profilin, on actin cytoskeletal regulation, motility, and invasion of breast cancer cells
21725608 Oral squamous cell carcinomas with weak PFN2 expression were associated with a significantly worse prognosis than strongly expressed tumours.
18573880 A signaling pathway from ROCK1 to profilin controls polyglutamine protein aggregation.
17382517 These findings raise the possibility that Rgl3 mediates interaction between Ras/Rap-family proteins and profilin II, an important activator of actin polymerization.

AA Sequence

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK      1 - 70
CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF     71 - 140
//

Text Mined References (34)

PMID Year Title
26764407 2016 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ ?-1) and profilin 2.
26354229 2015 Epigenetic regulation of Smad2 and Smad3 by profilin-2 promotes lung cancer growth and metastasis.
25964982 2015 Profilin 2 promotes migration, invasion, and stemness of HT29 human colorectal cancer stem cells.
23827010 2013 Profilin-1 versus profilin-2: two faces of the same coin?
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23153535 2012 Differential remodeling of actin cytoskeleton architecture by profilin isoforms leads to distinct effects on cell migration and invasion.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21725608 2011 Decreased expression of profilin 2 in oral squamous cell carcinoma and its clinicopathological implications.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...