Property Summary

NCBI Gene PubMed Count 34
PubMed Score 88.90
PubTator Score 143.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 1.100 4.4e-03
chronic rhinosinusitis -1.080 3.0e-02
glioblastoma -1.200 9.2e-03
interstitial cystitis -1.600 2.5e-04
intraductal papillary-mucinous adenoma (... -1.500 3.4e-03
intraductal papillary-mucinous carcinoma... -1.800 2.7e-02
invasive ductal carcinoma 1.700 3.0e-03
lung cancer 2.900 2.9e-05
lung carcinoma 2.900 3.9e-18
non-small cell lung cancer 2.269 1.3e-18
osteosarcoma 1.853 9.7e-04
psoriasis -1.200 1.0e-07
ulcerative colitis -1.600 2.1e-03

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK      1 - 70
CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF     71 - 140
//

Text Mined References (37)

PMID Year Title