Property Summary

NCBI Gene PubMed Count 31
Grant Count 50
R01 Count 38
Funding $6,654,215.19
PubMed Score 89.63
PubTator Score 143.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -2.600 0.000
osteosarcoma 1.853 0.001
glioblastoma -1.200 0.009
non-small cell lung cancer 2.269 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.003
intraductal papillary-mucinous carcinoma... -1.800 0.027
lung cancer 3.200 0.000
interstitial cystitis -1.600 0.000
lung carcinoma 2.900 0.000
invasive ductal carcinoma 1.700 0.003
ulcerative colitis -1.600 0.002
Breast cancer 1.100 0.004
chronic rhinosinusitis -1.080 0.030

Gene RIF (8)

PMID Text
26764407 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ alpha-1) and profilin 2.
26354229 Pfn2 suppresses the recruitment of HDAC1 to Smad2 and Smad3 promoters, increasing their expression, and, in turn, enhancing TGFB1 induced epithelial-mesenchymal transformation and VEGF and CTGF production.
25964982 Therefore, this study indicates that profilin 2 affects the metastatic potential and stemness of colorectal CSCs by regulating EMT- and stemness-related proteins.
23898208 HIV-1 Tat downregulates the expression of profilin 2 (PFN2) in human primary T cells
23827010 effects of profilin-1 and profilin-2, the two major isoforms of profilin, on actin cytoskeletal regulation, motility, and invasion of breast cancer cells
21725608 Oral squamous cell carcinomas with weak PFN2 expression were associated with a significantly worse prognosis than strongly expressed tumours.
18573880 A signaling pathway from ROCK1 to profilin controls polyglutamine protein aggregation.
17382517 These findings raise the possibility that Rgl3 mediates interaction between Ras/Rap-family proteins and profilin II, an important activator of actin polymerization.

AA Sequence

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK      1 - 70
CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF     71 - 140
//

Text Mined References (34)

PMID Year Title
26764407 2016 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ ?-1) and profilin 2.
26354229 2015 Epigenetic regulation of Smad2 and Smad3 by profilin-2 promotes lung cancer growth and metastasis.
25964982 2015 Profilin 2 promotes migration, invasion, and stemness of HT29 human colorectal cancer stem cells.
23827010 2013 Profilin-1 versus profilin-2: two faces of the same coin?
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23153535 2012 Differential remodeling of actin cytoskeleton architecture by profilin isoforms leads to distinct effects on cell migration and invasion.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21725608 2011 Decreased expression of profilin 2 in oral squamous cell carcinoma and its clinicopathological implications.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...