Property Summary

NCBI Gene PubMed Count 44
PubMed Score 736.63
PubTator Score 69.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis -1.800 6.6e-06
Breast cancer -1.400 1.1e-04
colon cancer -2.700 4.0e-04
ependymoma 1.700 3.6e-06
interstitial cystitis -1.300 8.0e-03
intraductal papillary-mucinous adenoma (... 2.100 1.2e-04
intraductal papillary-mucinous carcinoma... 1.700 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.1e-02
lung cancer -2.000 3.6e-05
nasopharyngeal carcinoma -1.300 5.5e-03
pituitary cancer 1.500 1.6e-04
psoriasis -1.200 5.0e-06
spina bifida -2.420 2.9e-02
urothelial carcinoma -1.500 4.8e-02

Gene RIF (28)

AA Sequence

MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCP      1 - 70
KQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCT     71 - 140
CCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA                                    141 - 178
//

Text Mined References (47)

PMID Year Title