Property Summary

NCBI Gene PubMed Count 42
PubMed Score 681.62
PubTator Score 69.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Erythropoietic protoporphyria 15
Disease Target Count P-value
psoriasis 6685 2.15219886879587E-243
Atopic dermatitis 944 1.02492291443839E-8
posterior fossa group B ependymoma 1530 3.64339188026925E-6
lung cancer 4473 3.61802994363047E-5
Breast cancer 3099 1.11367604537436E-4
pituitary cancer 1972 1.61899134716037E-4
colon cancer 1475 4.04640145845584E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.9017928200087E-4
interstitial cystitis 2299 0.00333320580594957
nasopharyngeal carcinoma 1056 0.00549541658195809
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0108844107723675
spina bifida 1064 0.0292072213563296
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0446969871733403
urothelial carcinoma 318 0.0481884316142262
Disease Target Count Z-score Confidence
Cancer 2346 3.568 1.8
diabetes mellitus 1663 3.106 1.6

Expression

  Differential Expression (14)

Synonym

Accession P35070 Q96F48
Symbols

Gene

BTC

PANTHER Protein Class (2)

PDB

1IOX   1IP0  

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (27)

PMID Text
24629040 CXCL8 production from lung cancer cells could be initiated by an autocrine mechanism or external sources of BTC.
24092824 Data suggest that BTC (betacellulin), AREG (amphiregulin), and EREG (epiregulin) induced prostaglandin E2 production by induction of COX-2 (prostaglandin-endoperoxide synthase 2) through MAP kinase signaling in granulosa cells.
22183345 BTC has properties of increasing retinal vascular leakage that could contribute to the development of diabetic retinopathy.
20530572 Data suggest a novel receptor-independent role for betacellulin intracellular-domain fragment signaling due to its ability to inhibit cell growth in vitro.
20165885 These are the first data that demonstrate an influence of betacellulin upon mesenchymal stem cells and the first to implicate HIF-alpha in betacellulin-mediated proliferation.
18508082 These results indicate the possibility of designing BTC mutants, which have an activity of inducing differentiation only, without facilitating growth promotion.
17962208 1st report of BTC expression in breast cancer. Its expression was lower in lobular breast cancers than in ductal carcinomas.
17895248 the ADAM10 prodomain inhibits betacellulin shedding, demonstrating that it could be of potential use as a therapeutic agent to treat cancer.
17525275 In vivo, EGFR signaling is hyperactive in tumor cells of skin SCC but not of BCC, and in nearby asymptomatic epidermis of both tumor types. Hyperactivation is due to upregulation of EGFR ligands AREG, HBEGF and TGFA, and downregulation of BTC
17479438 Variants in the betacellulin gene do not play a major role in the development of type 2 diabetes in an Amish Caucasian populations
More...

AA Sequence

MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCP      1 - 70
KQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCT     71 - 140
CCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA                                    141 - 178
//

Text Mined References (45)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24629040 2014 Regulatory mechanisms of betacellulin in CXCL8 production from lung cancer cells.
24440602 2014 The ABC of BTC: structural properties and biological roles of betacellulin.
24092824 2013 EGF-like growth factors induce COX-2-derived PGE2 production through ERK1/2 in human granulosa cells.
22183345 2012 Regulation of retinal vascular permeability by betacellulin.
20530572 2010 Sequential and gamma-secretase-dependent processing of the betacellulin precursor generates a palmitoylated intracellular-domain fragment that inhibits cell growth.
20165885 2010 Betacellulin inhibits osteogenic differentiation and stimulates proliferation through HIF-1alpha.
19740107 2009 Epidermal growth factor receptor ligands as new extracellular targets for the metastasis-promoting S100A4 protein.
18508082 2008 A betacellulin mutant promotes differentiation of pancreatic acinar AR42J cells into insulin-producing cells with low affinity of binding to ErbB1.
More...