Property Summary

NCBI Gene PubMed Count 43
Grant Count 94
R01 Count 73
Funding $7,483,740.58
PubMed Score 224.62
PubTator Score 104.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 0.016
psoriasis 1.100 0.002
osteosarcoma 3.179 0.000
glioblastoma 1.300 0.002
medulloblastoma, large-cell -1.700 0.012
non-small cell lung cancer 1.965 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.000
pediatric high grade glioma 1.300 0.001
group 4 medulloblastoma -1.100 0.001
ovarian cancer 1.600 0.001

Synonym

Accession P35052 B3KTD1 Q53QM4
Symbols glypican

Gene

PDB

4ACR   4AD7   4BWE   4YWT  

Gene RIF (25)

PMID Text
26517809 Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis.
26203194 The C terminus is shown to be highly flexible in solution, but it orients the core protein transverse to the membrane, directing a surface evolutionarily conserved in Gpc1 orthologs toward the membrane, where it may interact with signaling molecules
26106858 GPC1(+) crExos were detected in the serum of patients with pancreatic cancer with absolute specificity and sensitivity, distinguishing healthy subjects and patients with a benign pancreatic disease in patients with early-and late-stage pancreatic cancer.
25505242 The interaction of HIV-1 CA with human cellular glypican 1 protein (GPC1) is identified by yeast two-hybrid screen
25046223 differences in expression among different subtypes of ameloblastomas
24463821 GPC1 and FGFR1 are targets for regulation of their gene expression by miR-149.
23736812 DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (GPC1) of which 62% are hypermethylated.
23624389 We now report that human primary suture mesenchymal cells coexpress GPC1 and GPC3 on the cell surface and release them into the media
22351761 Crystal structure of N-glycosylated human glypican-1 core protein shows the structure of two loops evolutionarily conserved in vertebrate glypican-1
21932778 Mutagenesis and enzymatic cleavage indicated that the potential N-glycosylation sites are invariably occupied.
More...

AA Sequence

MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCT      1 - 70
SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARA     71 - 140
FRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELR    141 - 210
LRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCL    211 - 280
ANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNP    281 - 350
QGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA    351 - 420
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS    421 - 490
GDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR      491 - 558
//

Text Mined References (50)

PMID Year Title
26517809 2015 Novel insights into Notum and glypicans regulation in colorectal cancer.
26203194 2015 Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
26106858 2015 Glypican-1 identifies cancer exosomes and detects early pancreatic cancer.
25046223 2015 Differential expression of glypican-1 in ameloblastoma variants.
24463821 2014 Autoregulation of glypican-1 by intronic microRNA-149 fine tunes the angiogenic response to FGF2 in human endothelial cells.
23736812 2013 Epigenetic modulation of signal transduction pathways in HPV-associated HNSCC.
23624389 2013 Regulation of bone morphogenetic protein signalling and cranial osteogenesis by Gpc1 and Gpc3.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22351761 2012 Crystal structure of N-glycosylated human glypican-1 core protein: structure of two loops evolutionarily conserved in vertebrate glypican-1.
21932778 2011 The structural role of N-linked glycans on human glypican-1.
More...