Property Summary

NCBI Gene PubMed Count 49
PubMed Score 232.26
PubTator Score 104.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 1.6e-02
glioblastoma 1.300 1.9e-03
group 4 medulloblastoma -1.100 1.2e-03
intraductal papillary-mucinous adenoma (... -1.400 3.8e-05
medulloblastoma, large-cell -1.700 1.2e-02
non-small cell lung cancer 1.127 7.0e-11
osteosarcoma 3.179 4.6e-04
ovarian cancer 1.600 7.4e-04
pediatric high grade glioma 1.300 1.3e-03
psoriasis 1.100 2.3e-03

Protein-protein Interaction (8)

Gene RIF (29)

AA Sequence

MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCT      1 - 70
SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARA     71 - 140
FRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELR    141 - 210
LRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCL    211 - 280
ANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNP    281 - 350
QGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA    351 - 420
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS    421 - 490
GDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR      491 - 558
//

Text Mined References (56)

PMID Year Title