Property Summary

NCBI Gene PubMed Count 37
Grant Count 90
R01 Count 52
Funding $10,264,255.87
PubMed Score 510.97
PubTator Score 108.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35030 A8CED1 A8CED3 A9Z1Y4 E7ES07 F8W7P3 P15951 Q15665 Q5VXV0 Q6ISJ4 Q9UQV3
Symbols T9
MTG
TRY3
TRY4
PRSS4

Gene

PANTHER Protein Class (3)

PDB

4U32   4U30   1H4W   2R9P   3L33   3L3T   3P92   3P95   4DG4   5C67  

Gene RIF (27)

PMID Text
26318044 Data show that silencing tumor-endothelial cells (EC) for trypsinogen 4 accumulated tissue factor pathway inhibitor-2 (TFPI-2) in the matrix.
26175157 These findings suggest that inhibitor cleavage represents a functional adaptation of mesotrypsin that may have evolved in response to positive selection pressure.
25735255 High PRSS3 expression in EOC tissues was significantly associated with advanced FIGO stage and lymph node metastasis.
25301953 Data suggest that mesotrypsin cleavage of Kunitz domains may contribute to cancer progression.
24872419 Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models.
24146905 extra-pancreatic trypsinogen 3 is produced by esophageal adenocarcinoma cells and activates PAR-2 in an autocrine manner.
22042864 IFN regulatory factor 2 (Irf2) has a regulatory role in trypsinogen5 gene transcription, which is resistant to a major endogenous trypsin inhibitor, Spink3
20947888 PRSS3 plays an important role in the progression, metastasis and prognosis of human pancreatic cancer.
20484962 Investigation did not reveal an association between PRSS3 variants and chronic pancreatitis.
20484962 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGT      1 - 70
VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG     71 - 140
NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGAD    141 - 210
YPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWK    211 - 280
NRPGVYTKVYNYVDWIKDTIAANS                                                  281 - 304
//

Text Mined References (40)

PMID Year Title
26318044 2015 Trypsinogen 4 boosts tumor endothelial cells migration through proteolysis of tissue factor pathway inhibitor-2.
26175157 2015 Mesotrypsin Has Evolved Four Unique Residues to Cleave Trypsin Inhibitors as Substrates.
25735255 2015 PRSS3 expression is associated with tumor progression and poor prognosis in epithelial ovarian cancer.
25301953 2014 Sequence and conformational specificity in substrate recognition: several human Kunitz protease inhibitor domains are specific substrates of mesotrypsin.
24872419 2014 Mesotrypsin and caspase-14 participate in prosaposin processing: potential relevance to epidermal permeability barrier formation.
24146905 2013 Autocrine extra-pancreatic trypsin 3 secretion promotes cell proliferation and survival in esophageal adenocarcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22042864 2011 Characterization of dsRNA-induced pancreatitis model reveals the regulatory role of IFN regulatory factor 2 (Irf2) in trypsinogen5 gene transcription.
20947888 2010 PRSS3 promotes tumour growth and metastasis of human pancreatic cancer.
20484962 2010 Complete analysis of the human mesotrypsinogen gene (PRSS3) in patients with chronic pancreatitis.
More...