Property Summary

Ligand Count 8
NCBI Gene PubMed Count 39
PubMed Score 549.45
PubTator Score 108.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (20)

 GWAS Trait (1)

Gene RIF (29)

AA Sequence

MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGT      1 - 70
VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG     71 - 140
NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGAD    141 - 210
YPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWK    211 - 280
NRPGVYTKVYNYVDWIKDTIAANS                                                  281 - 304
//

Text Mined References (42)

PMID Year Title