Property Summary

NCBI Gene PubMed Count 225
Grant Count 585
R01 Count 297
Funding $57,790,939.88
PubMed Score 704.18
PubTator Score 413.49

Knowledge Summary

Patent (23,031)

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.600 0.000
adult high grade glioma -1.500 0.000
pilocytic astrocytoma -1.100 0.000
psoriasis -2.200 0.000

Synonym

Accession P34998 B4DIE9 Q13008 Q4QRJ1 Q9UK64 CRF-R-1
Symbols CRF1
CRHR
CRF-R
CRFR1
CRF-R1
CRFR-1
CRH-R1
CRHR1L
CRF-R-1
CRH-R-1

Gene

PDB

2L27   3EHS   3EHT   3EHU   4K5Y   4Z9G  

  TechDev Info (1)

Gene RIF (203)

PMID Text
26940669 hsa-miR-34a can regulate the CRH/CRHR1/POMC axis and may influence body mass index.
26206446 The CRHR1 gene reduces the risk for depressive symptoms among youths living in families undergoing high levels of economic hardship.
26115868 CAL can regulate the anterograde trafficking, the internalization as well as the signaling of CRFR1 via modulating the post-translational modifications that the receptor undergoes at the Golgi apparatus.
25960164 CRF-R1 activation by CRF and UCN inhibits the proliferation of SK-N-SH (N) cells and promotes neuronal-like differentiation.
25954915 The results suggested no association between the CRHR1 gene single nucleotide polymorphisms and infantile spasms in a Chinese population.
25802844 The involvement of CRHR1 in ND.
25712009 CRHR1 gene SNP rs242941 polymorphism is associated with better response to systemic corticosteroid during acute exacerbation of asthma.
25648046 results found that among children with no copies of the protective CRHR1 TAT haplotype, children of mothers with a history of Manic Depressive Disorder had significantly higher levels of brooding than children of mothers with no history of depression.
25640828 The results revealed that changes in depressive symptoms over time depended on both intervention group and genotypes (5-HTTLPR and CRHR1).
25630718 the present study demonstrates that the expression of CRH/CRH-R1 in lesions of chronic plaque psoriasis is lower than that in psoriatic perilesional skin and normal control skin.
More...

AA Sequence

MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPA      1 - 70
FFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVL     71 - 140
FLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVH    141 - 210
QSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKL    211 - 280
YYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLP    281 - 350
LLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV    351 - 420
ARAMSIPTSPTRVSFHSIKQSTAV                                                  421 - 444
//

Text Mined References (230)

PMID Year Title
26940669 2016 Hsa-miR-34a mediated repression of corticotrophin releasing hormone receptor 1 regulates pro-opiomelanocortin expression in patients with complex regional pain syndrome.
26206446 2015 Family Economic Hardship, Corticotropin-Releasing Hormone Receptor Polymorphisms, and Depressive Symptoms in Rural African-American Youths.
26115868 2015 Role of cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) in regulating the trafficking and signaling of corticotropin-releasing factor receptor 1.
25960164 2015 The activation of type 1 corticotropin releasing factor receptor (CRF-R1) inhibits proliferation and promotes differentiation of neuroblastoma cells in vitro via p27(Kip1) protein up-regulation and c-Myc mRNA down-regulation.
25954915 2015 Association analysis of polymorphisms of the CRHR1 gene with infantile spasms.
25802844 2015 Ethnic-specific genetic association of variants in the corticotropin-releasing hormone receptor 1 gene with nicotine dependence.
25712009 2015 CRHR1 Gene SNPs and Response to Systemic Corticosteroids in Indian Asthmatic Children During Acute Exacerbation.
25648046 2016 Influence of maternal depression on children's brooding rumination: Moderation by CRHR1 TAT haplotype.
25640828 2015 Genetic moderation of interpersonal psychotherapy efficacy for low-income mothers with major depressive disorder: implications for differential susceptibility.
25630718 2015 Inhibiting interleukin-18 production through the mitogen-activated protein kinase pathway, a potential role of corticotropin-releasing hormone in chronic plaque psoriasis.
More...