Property Summary

NCBI Gene PubMed Count 49
Grant Count 211
R01 Count 161
Funding $18,851,149
PubMed Score 387.16
PubTator Score 198.10

Knowledge Summary

Patent (33,999)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.600 0.001
osteosarcoma 2.098 0.000
ovarian cancer -1.100 0.000

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (41)

PMID Text
25289898 NF-kappaB inhibitor suppressed 17-PT-PGE2-mediated FoxC2 upregulation. Immunohistochemistry showed p65, FoxC2, EP1 receptor and beta1-integrin were all highly expressed in the HCC cases
24614038 A transient interaction between COX-2 and EP1 constitutes a feedback loop whereby an increase in COX-2 expression elevates EP1.
24333447 COX-1, H446K' is significantly more sensitive to downregulation by EP . Together these data suggest that distinctive ubiquitination of COX-1 and COX-2 may be responsible for their different sensitivity to EP -mediated degradation.
23842570 through complex formation with D1, EP1 signaling directs the D1 receptor through G(betagamma) to be coupled to AC7.
23525457 Our study suggests that the PGE EP1 receptor regulates FAK phosphorylation by activating the PKC/c-Src and EGFR signal pathways, which may coordinately regulate adhesion and migration in HCC
23494562 PGE2-enhanced MMP2 expression is mediated through EP1 receptors and calcium signaling pathway-induced CREB phosphorylation in human cholangiocarcinoma cells.
22924768 PGE(2) -mediated NF-kappaB activation by simultaneous stimulation of EP(1) and EP(4) receptors induces maximal IL-8 promoter activation and IL-8 mRNA and protein induction
22555372 Suggest that the anti-carcinogenic effects of EGCG in hepatocellular carcinoma might be mediated, at least partially, through the suppressing EP(1) receptor expression and PGE(2) production.
22474323 new role for the EP(1) receptor in resolving inflammation through down-regulation of COX-2.
22276108 Neuroblastoma express all four forms of PGE(2) receptors.
More...

AA Sequence

MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQAAGRLRRRRSA      1 - 70
ATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVT     71 - 140
RPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYELQYPGTWCFIGLGPPGGWRQALLAGLFASL    141 - 210
GLVALLAALVCNTLSGLALLRARWRRRSRRPPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSR    211 - 280
SSGSARRARAHDVEMVGQLVGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWV    281 - 350
YILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF                      351 - 402
//

Text Mined References (49)

PMID Year Title
25289898 2014 Prostaglandin E2 stimulates ?1-integrin expression in hepatocellular carcinoma through the EP1 receptor/PKC/NF-?B pathway.
24614038 2014 Upregulation of prostaglandin receptor EP1 expression involves its association with cyclooxygenase-2.
24333447 2014 Prostaglandin receptor EP?-mediated differential degradation of cyclooxygenases involves a specific lysine residue.
23842570 2013 Prostaglandin E receptor EP1 forms a complex with dopamine D1 receptor and directs D1-induced cAMP production to adenylyl cyclase 7 through mobilizing G(??) subunits in human embryonic kidney 293T cells.
23525457 2013 Prostaglandin E? receptor EP1-mediated phosphorylation of focal adhesion kinase enhances cell adhesion and migration in hepatocellular carcinoma cells.
23494562 2013 Prostaglandin E2 receptor EP1 phosphorylate CREB and mediates MMP2 expression in human cholangiocarcinoma cells.
22924768 2013 NF-?B-dependent IL-8 induction by prostaglandin E(2) receptors EP(1) and EP(4).
22555372 2012 Prostanoid EP1 receptor as the target of (-)-epigallocatechin-3-gallate in suppressing hepatocellular carcinoma cells in vitro.
22474323 2012 Prostaglandin EP1 receptor down-regulates expression of cyclooxygenase-2 by facilitating its proteasomal degradation.
22276108 2012 Autocrine prostaglandin E2 signaling promotes tumor cell survival and proliferation in childhood neuroblastoma.
More...