Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.82
PubTator Score 36.69

Knowledge Summary

Patent (586)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.0e-05
psoriasis 6694 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Infertility 188 3.091 1.5

Gene RIF (3)

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSRLHTPVYFFLANLSFTD      1 - 70
LFFVTNTIPKMLVNLQSHNKAISYAGCLTQLYFLVSLVALDNLILAVMAYDRYVAICCPLHYTTAMSPKL     71 - 140
CILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCEMYVLLRMACSNIQINHTVLIATGCFIFLIP    141 - 210
FGFVIISYVLIIRAILRIPSVSKKYKAFSTCASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVV    211 - 280
TPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT                                          281 - 312
//

Text Mined References (19)

PMID Year Title