Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.82
PubTator Score 36.69

Knowledge Summary

Patent (586)


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.03370072790282E-5
psoriasis 6685 0.00196390942794159
Disease Target Count Z-score Confidence
Infertility 163 3.105 1.6


Accession P34982 Q6IFL8 Q96RA4 Q9UM78
Symbols OLFR1


  Ortholog (5)

Gene RIF (3)

23525651 The present preliminary study seems to confirm the important role of OR1D2 both in nose and spermatozoa and may explain the idiopathic infertility of the study group.
21454689 the homo-oligomerization status of the human OR1740 receptor and its involvement in receptor activation upon odorant ligand binding were addressed
12663925 results indicate that hOR17-4 functions in human sperm chemotaxis and may be a critical component of the fertilization process

AA Sequence

TPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT                                          281 - 312

Text Mined References (17)

PMID Year Title
23525651 2013 Human olfactory sensitivity for bourgeonal and male infertility: a preliminary investigation.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
21454689 2011 Relationship between homo-oligomerization of a mammalian olfactory receptor and its activation state demonstrated by bioluminescence resonance energy transfer.
16820410 2006 Novel function of beta-arrestin2 in the nucleus of mature spermatozoa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458659 2004 Dual capacity of a human olfactory receptor.
14983052 2004 The human olfactory receptor gene family.
12663925 2003 Identification of a testicular odorant receptor mediating human sperm chemotaxis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.