Property Summary

NCBI Gene PubMed Count 29
Grant Count 18
R01 Count 4
Funding $3,919,079.69
PubMed Score 70.28
PubTator Score 82.78

Knowledge Summary

Patent (4,964)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000

 GWAS Trait (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
485365 summary 0 / 0 / 0 qHTS for Small Molecule Agonists and Allosteric Enhancers of Human TRH Receptor: Agonists Summary
493056 screening 2424 / 0 / 362204 qHTS for Small Molecule Agonists and Allosteric Enhancers of Human TRH Receptor: Primary Screen for Enhancers
493076 confirmatory 0 / 65 / 905 qHTS for Small Molecule Agonists and Allosteric Enhancers of Human TRH Receptor: Confirmation Screen for Enhancers
493078 confirmatory 80 / 117 / 773 qHTS for Small Molecule Agonists and Allosteric Enhancers of Human TRH Receptor: Confirmation Screen for Agonists
493084 screening 651 / 0 / 363977 qHTS for Small Molecule Agonists and Allosteric Enhancers of Human TRH Receptor: Primary Screen for Agonists.
493127 screening 7 / 0 / 1273 qHTS for Small Molecule Agonists and Allosteric Enhancers of Human TRH Receptor: Validation Screen for Agonists

Gene RIF (13)

PMID Text
23543262 rs16892496 polymorphism in the TRHR gene may play a role in FFM variation.
23333304 HIV-1 Vif downregulates the expression of thyrotropin-releasing hormone receptor (TRHR) in Vif-expression T cells
22240728 The precoupling of receptors with their cognate G-proteins can contribute to faster G-protein activation and subsequent signal transfer into the cell interior.
20345371 Data show that interactions of TRHR with GRKs and phosphatases are determined not simply by the amino acid sequences of the substrates, but by regions outside the cytoplasmic tails.
19906838 A mutation in thyrotropin-releasing hormone receptor almost completely prevented receptor phosphorylation.
19541745 analysis of the effect of subcellular trafficking of the TRH receptor
19268274 TRHR gene is an important gene for LBM variation.
19268274 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18724972 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVA      1 - 70
DLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFS     71 - 140
RAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCGYKISRNYYSPIYLMDFGVFYVVPMILATVL    141 - 210
YGFIARILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWM    211 - 280
PYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSV    281 - 350
ALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS                          351 - 398
//

Text Mined References (29)

PMID Year Title
23543262 2013 Association between polymorphisms in the TRHR gene, fat-free mass, and muscle strength in older women.
22240728 2012 Identification of a preassembled TRH receptor-G(q/11) protein complex in HEK293 cells.
20345371 2010 Importance of regions outside the cytoplasmic tail of G-protein-coupled receptors for phosphorylation and dephosphorylation.
19906838 2010 Role of helix 8 of the thyrotropin-releasing hormone receptor in phosphorylation by G protein-coupled receptor kinase.
19541745 2009 Subcellular trafficking of the TRH receptor: effect of phosphorylation.
19268274 2009 Genome-wide association and replication studies identified TRHR as an important gene for lean body mass.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18724972 2008 Sex differences in environmental and genetic factors for hypertension.
16020481 2005 Regulated dimerization of the thyrotropin-releasing hormone receptor affects receptor trafficking but not signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...