Property Summary

NCBI Gene PubMed Count 170
Grant Count 40
R01 Count 9
Funding $4,860,533.99
PubMed Score 240.41
PubTator Score 829.99

Knowledge Summary

Patent (13,853)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.500 0.003
osteosarcoma 1.694 0.000
medulloblastoma, large-cell 1.300 0.000
ovarian cancer 1.200 0.000

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
2835 confirmatory 0 / 0 / 38 SAR analysis of agonists of the Cannabinoid Receptor 2 using an Image-Based Assay
2836 confirmatory 0 / 0 / 38 SAR analysis of antagonists of the Cannabinoid Receptor 2 using an Image-Based Assay
434922 confirmatory 0 / 0 / 60 SAR analysis of antagonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 2
434928 confirmatory 2 / 0 / 58 SAR analysis of agonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 2
485277 confirmatory 11 / 0 / 57 SAR analysis of agonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 3
485278 confirmatory 8 / 0 / 60 SAR analysis of antagonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 3
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
More...

Gene RIF (188)

PMID Text
26775260 Induction of apoptosis was mediated via CB1 as well as CB2, and expression of CB receptors was a prerequisite for therapy response in our models.
26467187 Human lung-resident macrophages express CB1 and CB2 receptors whose activation inhibits the release of angiogenic and lymphangiogenic factors
26447698 Association between the CB2 Q63R functional variant and the age at menarche in obese girls.
26195631 Data show that HU308 and JWH133 enhanced human and mouse breast cancer cell-induced osteoclastogenesis and exacerbated osteolysis.
26062417 up-regulated expression of hCB2R could induce cell apoptosis by enhancing the expressions of Bax, Bad and suppressing the expression of Bcl-2 in Caski cells
26055357 CNR2 gene has an important role in the etiology of osteoporosis and suggest that it may be a genetic risk factor for BMD and osteoporosis in Han Chinese postmenopausal women.
25974389 Cannabinoid receptor type 2 contributes to susceptibility to oligo/polyarticular juvenile idiopathic arthritis and to the severity of its clinical course.
25863279 Study demonstrates the up-regulation of CB2 receptors in glial elements in postmortem tissues of Parkinson's disease patients and an inflammatory mouse model
25855725 findings reveal an unprecedented role of CB2 as a pivotal regulator of HER2 pro-oncogenic signaling in breast cancer, and they suggest that CB2 may be a biomarker with prognostic value in these tumors.
25749560 A histological activity index (HAI) > 8 (Ishak scoring) was more frequent in patients with CB2-63 RR than in those with CB2-63 QR or QQ (37% vs. 16.7%, p < 0.05).
More...

AA Sequence

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSY      1 - 70
LFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPS     71 - 140
YKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYG    141 - 210
HVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKA    211 - 280
FAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWP    281 - 350
DSRDLDLSDC                                                                351 - 360
//

Text Mined References (175)

PMID Year Title
26775260 2016 Dronabinol has preferential antileukemic activity in acute lymphoblastic and myeloid leukemia with lymphoid differentiation patterns.
26467187 2016 Human lung-resident macrophages express CB1 and CB2 receptors whose activation inhibits the release of angiogenic and lymphangiogenic factors.
26447698 2015 The Cannabinoid Receptor 2 Q63R Variant Modulates the Relationship between Childhood Obesity and Age at Menarche.
26195631 2015 Bone Cell-autonomous Contribution of Type 2 Cannabinoid Receptor to Breast Cancer-induced Osteolysis.
26062417 2015 [Over-expression of cannabinoid receptor 2 induces the apoptosis of cervical carcinoma Caski cells].
26055357 2015 Evaluation of common variants in CNR2 gene for bone mineral density and osteoporosis susceptibility in postmenopausal women of Han Chinese.
25974389 2015 Association between cannabinoid receptor type 2 Q63R variant and oligo/polyarticular juvenile idiopathic arthritis.
25863279 2016 Potential of the cannabinoid CB(2) receptor as a pharmacological target against inflammation in Parkinson's disease.
25855725 2015 Role of cannabinoid receptor CB2 in HER2 pro-oncogenic signaling in breast cancer.
25749560 2015 The impact of the CB2-63 polymorphism on the histological presentation of chronic hepatitis B.
More...