Property Summary

Ligand Count 911
NCBI Gene PubMed Count 55
PubMed Score 13643.65
PubTator Score 44.98

Knowledge Summary

Patent (47,431)

TINX Plot

  Disease (6)

Disease Target Count
Major Depressive Disorder 301
Disease Target Count P-value
psoriasis 6694 9.5e-64
malignant mesothelioma 3232 3.6e-04
facioscapulohumeral dystrophy 288 5.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 5.1e-03
malignant mesothelioma -1.200 3.6e-04
psoriasis 2.100 9.5e-64

Gene RIF (41)

AA Sequence

MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGC      1 - 70
GEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSV     71 - 140
TDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLS    141 - 210
ASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPR    211 - 280
VEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTAR    281 - 350
PFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK    351 - 420
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD               421 - 479
//

Text Mined References (59)

PMID Year Title