Property Summary

NCBI Gene PubMed Count 25
Grant Count 41
R01 Count 15
Funding $3,524,647.6
PubMed Score 90.15
PubTator Score 127.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
1209 confirmatory 814 / 0 / 193412 HTS identification of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1214 screening 11 / 0 / 194215 HTS identification of compounds activating phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1216 screening 656 / 0 / 193570 HTS identification of compounds activating phosphomannose isomerase (PMI) via a fluorescence intensity assay using a near- saturating concentration of mannose 6-phosphat
1220 confirmatory 1288 / 0 / 192938 HTS identification of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay using a high concentration of mannose 6-phosphate
1535 confirmatory 129 / 0 / 73 Confirmation of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1536 confirmatory 4 / 0 / 12 Confirmation of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay using a high concentration of mannose 6-phosphate.
1545 summary 2 / 0 / 0 Summary - Compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1553 other 34 / 0 / 56 Screening for Phosphomannose Isomerase inhibitors in cellular based assay using Hela cells.
1620 other 51 / 0 / 39 Toxicity Screening of PMI Inhibitors in Hela cells

Gene RIF (4)

PMID Text
22082156 Knockdown of mannose phosphate isomerase (MPI) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21949237 Phosphomannose isomerase inhibitors improve N-glycosylation in selected phosphomannomutase-deficient fibroblasts
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
16488169 The mannose-6-phosphate-enzyme complex is developed and the key residues involved in the ligand binding are determined. Our results suggest a hydride transfer mechanism of alpha-hydrogen between the C1 and C2 positions.

AA Sequence

MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKT      1 - 70
LSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAI     71 - 140
ALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVV    141 - 210
EQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLK    211 - 280
GDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKT    281 - 350
EVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC    351 - 420
CLL                                                                       421 - 423
//

Text Mined References (27)

PMID Year Title
24407290 2014 The metabolic origins of mannose in glycoproteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21949237 2011 Phosphomannose isomerase inhibitors improve N-glycosylation in selected phosphomannomutase-deficient fibroblasts.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...