Property Summary

NCBI Gene PubMed Count 83
PubMed Score 75.07
PubTator Score 96.50

Knowledge Summary

Patent (7,616)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.05348934252176E-28
breast carcinoma 1614 1.88223032337509E-20
lung carcinoma 2844 3.09220859756396E-18
lung adenocarcinoma 2714 2.5292890538584E-11
ovarian cancer 8492 1.36971014397842E-10
malignant mesothelioma 3163 1.77216444683471E-8
ulcerative colitis 2087 2.7111511452774E-8
medulloblastoma, large-cell 6234 1.67317304785323E-5
interstitial cystitis 2299 5.94861010112531E-5
lung cancer 4473 1.09425856753257E-4
osteosarcoma 7933 2.14624789086814E-4
adult high grade glioma 2148 8.23650570702208E-4
ductal carcinoma in situ 1745 0.00170147005303493
invasive ductal carcinoma 2950 0.00445938427456936
X-linked cerebral adrenoleukodystrophy 115 0.00605023860300329
dermatomyositis 967 0.00791548055921849
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00835906707179816
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00849953947361019
astrocytic glioma 2241 0.0175736074931228
adrenocortical carcinoma 1427 0.023941355587636
aldosterone-producing adenoma 664 0.0378704929581223
adrenocortical adenoma 134 0.0381712985438634
esophageal adenocarcinoma 737 0.0404287990935003
Barrett's esophagus 185 0.0426600596541662
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 1.0
Type 2 diabetes mellitus 192 0.0 2.0

Expression

Synonym

Accession P34947 D3DRD0 Q5T059
Symbols GPRK5

Gene

PDB

4TNB   4TND  

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (58)

PMID Text
26820533 Thus, we provided new insight into the function of GRKs in agonist-unstimulated GPCR trafficking using a recombinant AM1 receptor and further determined the region of the CLR C-tail responsible for this GRK function.
26614013 We demonstrated that the SNPs and the related haplotypes of GRK5 could play a central role in predisposing Parkinson disease patients to cognitive impairment.
26515328 Specific patterns of altered heart GRK5 gene expression were found in models of cardiac hypertrophy.
26248277 Suggest a common regulatory pattern for the beta(1)-AR/GRK5 which is independent of cellular type or pathology.
26066465 ADORA2A and GRK5 gene variants may influence the etiology of malaria infection.
26032409 GRK5 is found in a partially closed state with its kinase domain C-tail forming novel interactions with nucleotide and the N-lobe.
25638254 This study sought to identify the distributed characteristics of these variant genotypes in Chinese population, and influence of GRK5 and ADRB1 polymorphisms on systolic heart failure morbidity.
25153362 These data suggest that increased GRK5 expression may contribute to the pathophysiology of schizophrenia.
25049040 G protein-coupled receptor kinase 5 gene polymorphisms may have a role in postoperative atrial fibrillation after coronary artery bypass grafting in patients receiving beta-blockers
25010510 A significant difference in the frequency of GRK5 polymorphism was found between Takotsubo cardiomyopathy patients and controls, supporting a genetic predisposition to this cardiac syndrome.
More...

AA Sequence

MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQPIGRLLFRQF      1 - 70
CETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKE     71 - 140
LFSACAQSVHEYLRGEPFHEYLDSMFFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK    141 - 210
MYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGN    211 - 280
PGFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVG    281 - 350
YMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC    351 - 420
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVN    421 - 490
LDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRNHPPEPPKKGLLQRLFKRQHQ    491 - 560
NNSKSSPSSKTSFNHHINSNHVSSNSTGSS                                            561 - 590
//

Text Mined References (88)

PMID Year Title
26820533 2016 Inhibitory effects of two G protein-coupled receptor kinases on the cell surface expression and signaling of the human adrenomedullin receptor.
26614013 2015 Role of G-protein coupled receptor kinase 5 gene in cognitive impairment in Parkinson's disease.
26515328 2015 Differential Role of G Protein-Coupled Receptor Kinase 5 in Physiological Versus Pathological Cardiac Hypertrophy.
26248277 2015 ?2- and ?1-Adrenoceptor Expression Exhibits a Common Regulatory Pattern With GRK2 and GRK5 in Human and Animal Models of Cardiovascular Diseases.
26066465 2015 Categorical complexities of Plasmodium falciparum malaria in individuals is associated with genetic variations in ADORA2A and GRK5 genes.
26032409 2015 Atomic Structure of GRK5 Reveals Distinct Structural Features Novel for G Protein-coupled Receptor Kinases.
25638254 2015 Effects of GRK5 and ADRB1 polymorphisms influence on systolic heart failure.
25153362 2014 Increased G protein-coupled receptor kinase (GRK) expression in the anterior cingulate cortex in schizophrenia.
25049040 2014 G protein-coupled receptor kinase 5 gene polymorphisms are associated with postoperative atrial fibrillation after coronary artery bypass grafting in patients receiving ?-blockers.
25010510 2015 G-protein-coupled receptor kinase 5 polymorphism and Takotsubo cardiomyopathy.
More...