Property Summary

NCBI Gene PubMed Count 83
Grant Count 90
R01 Count 51
Funding $21,938,176.93
PubMed Score 75.07
PubTator Score 96.50

Knowledge Summary

Patent (7,616)

Expression

Synonym

Accession P34947 D3DRD0 Q5T059
Symbols GPRK5

Gene

PDB

4TNB   4TND  

 GWAS Trait (1)

Gene RIF (58)

PMID Text
26820533 Thus, we provided new insight into the function of GRKs in agonist-unstimulated GPCR trafficking using a recombinant AM1 receptor and further determined the region of the CLR C-tail responsible for this GRK function.
26614013 We demonstrated that the SNPs and the related haplotypes of GRK5 could play a central role in predisposing Parkinson disease patients to cognitive impairment.
26515328 Specific patterns of altered heart GRK5 gene expression were found in models of cardiac hypertrophy.
26248277 Suggest a common regulatory pattern for the beta(1)-AR/GRK5 which is independent of cellular type or pathology.
26066465 ADORA2A and GRK5 gene variants may influence the etiology of malaria infection.
26032409 GRK5 is found in a partially closed state with its kinase domain C-tail forming novel interactions with nucleotide and the N-lobe.
25638254 This study sought to identify the distributed characteristics of these variant genotypes in Chinese population, and influence of GRK5 and ADRB1 polymorphisms on systolic heart failure morbidity.
25153362 These data suggest that increased GRK5 expression may contribute to the pathophysiology of schizophrenia.
25049040 G protein-coupled receptor kinase 5 gene polymorphisms may have a role in postoperative atrial fibrillation after coronary artery bypass grafting in patients receiving beta-blockers
25010510 A significant difference in the frequency of GRK5 polymorphism was found between Takotsubo cardiomyopathy patients and controls, supporting a genetic predisposition to this cardiac syndrome.
More...

AA Sequence

MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQPIGRLLFRQF      1 - 70
CETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKE     71 - 140
LFSACAQSVHEYLRGEPFHEYLDSMFFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK    141 - 210
MYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGN    211 - 280
PGFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVG    281 - 350
YMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC    351 - 420
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVN    421 - 490
LDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRNHPPEPPKKGLLQRLFKRQHQ    491 - 560
NNSKSSPSSKTSFNHHINSNHVSSNSTGSS                                            561 - 590
//

Text Mined References (88)

PMID Year Title
26820533 2016 Inhibitory effects of two G protein-coupled receptor kinases on the cell surface expression and signaling of the human adrenomedullin receptor.
26614013 2015 Role of G-protein coupled receptor kinase 5 gene in cognitive impairment in Parkinson's disease.
26515328 2015 Differential Role of G Protein-Coupled Receptor Kinase 5 in Physiological Versus Pathological Cardiac Hypertrophy.
26248277 2015 ?2- and ?1-Adrenoceptor Expression Exhibits a Common Regulatory Pattern With GRK2 and GRK5 in Human and Animal Models of Cardiovascular Diseases.
26066465 2015 Categorical complexities of Plasmodium falciparum malaria in individuals is associated with genetic variations in ADORA2A and GRK5 genes.
26032409 2015 Atomic Structure of GRK5 Reveals Distinct Structural Features Novel for G Protein-coupled Receptor Kinases.
25638254 2015 Effects of GRK5 and ADRB1 polymorphisms influence on systolic heart failure.
25153362 2014 Increased G protein-coupled receptor kinase (GRK) expression in the anterior cingulate cortex in schizophrenia.
25049040 2014 G protein-coupled receptor kinase 5 gene polymorphisms are associated with postoperative atrial fibrillation after coronary artery bypass grafting in patients receiving ?-blockers.
25010510 2015 G-protein-coupled receptor kinase 5 polymorphism and Takotsubo cardiomyopathy.
More...