Property Summary

NCBI Gene PubMed Count 251
PubMed Score 8441.31
PubTator Score 3498.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.58287875995639E-9
ovarian cancer 8492 7.93223245375181E-8
lung adenocarcinoma 2714 7.65665602037133E-6
pediatric high grade glioma 2712 3.89995718744889E-5
atypical teratoid / rhabdoid tumor 4369 6.79327995057833E-5
cystic fibrosis 1670 1.18015620085745E-4
lung cancer 4473 1.25904034127743E-4
medulloblastoma, large-cell 6234 3.95649222855167E-4
Multiple myeloma 1328 6.64967737947484E-4
psoriasis 6685 0.00145294975993804
osteosarcoma 7933 0.0030291060921478
Waldenstrons macroglobulinemia 765 0.00343334566498552
group 3 medulloblastoma 2254 0.00388020380769693
Pick disease 1893 0.0045977024682729
subependymal giant cell astrocytoma 2287 0.00505043972879617
oligodendroglioma 2849 0.00691793443166461
glioblastoma 5572 0.0133891972459922
adrenocortical carcinoma 1427 0.0161265556103924
Gaucher disease type 1 171 0.0216063471435243
non primary Sjogren syndrome sicca 840 0.0245405953012881
ependymoma 2514 0.0269048179704447

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.222 0.003
Multiple myeloma 1.598 0.001
ependymoma 1.400 0.027
oligodendroglioma 1.200 0.007
psoriasis 2.200 0.001
osteosarcoma 1.702 0.003
cystic fibrosis -1.109 0.000
glioblastoma 1.600 0.013
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.600 0.000
adrenocortical carcinoma 1.154 0.016
non-small cell lung cancer 1.180 0.000
lung cancer 1.300 0.000
diabetes mellitus -1.100 0.001
pediatric high grade glioma -1.100 0.000
group 3 medulloblastoma 1.100 0.004
non primary Sjogren syndrome sicca 1.100 0.025
subependymal giant cell astrocytoma 1.778 0.005
lung adenocarcinoma 1.095 0.000
Pick disease 1.400 0.005
ovarian cancer 3.500 0.000
Gaucher disease type 1 -1.600 0.022

Synonym

Accession P34932 O95756 Q2TAL4 Q9BUK9
Symbols RY
APG-2
HSPH2
hsp70
hsp70RY
HEL-S-5a
HS24/P52

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

 GO Function (1)

Gene RIF (241)

PMID Text
26565746 Both intrinsic affinity and post-translational modifications tune the interactions between the Hsp70 and Hsp90 proteins and the tetratricopeptide repeat (TPR) domain-containing cochaperones.
26559972 HSP70 suppression elevates FOXM1 expression, and simultaneous inhibition of FOXM1 and HSP70 increases the sensitivity of human cancer cells to anticancer drug-induced apoptosis.
26556859 Data suggest that dual heat shock proteins HSP90 and HSP70 inhibition can simultaneously disrupt the key signaling pathways in muscle invasive bladder cancer (MIBC).
26446645 Hsp70 overexpression likely plays an important role in the excessive collagen production by keloid fibroblasts. RNA interference has therapeutic potential for the treatment of keloids.
26439956 This study demonstrated that Heat shock protein 70 (Hsp70) interacts with the Notch1 intracellular domain and contributes to the activity of Notch signaling in myelin-reactive.
26286954 Data show that binding of heat shock proteins Hsp70 and Hsp90 requires prior binding of Hop protein to Hsp90.
26246424 As a chaperone of heat shock protein 70 (HSP70), HBP21 could inhibit interaction between HSP70 and Bax, increased Bax protein translocation from cytoplasm to mitochondria.
26183779 Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine.
26165468 AIF bears a HSP-70 binding domain allowing association with HSP-70.
26050647 quercetin-induced inhibition is involved in growth inhibition and sensitization to chemotherapy in lung cancer cells
More...

AA Sequence

MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRF      1 - 70
HGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDC     71 - 140
VVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQV    141 - 210
SVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSAN    211 - 280
ASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAV    281 - 350
KEKISKFFGKELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF    351 - 420
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIF    421 - 490
SVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKK    491 - 560
MDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENEGKMIMQDKLEKERNDAKNAVEEYVYEMRD    561 - 630
KLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFE    631 - 700
ELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEA    701 - 770
KIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID    771 - 840
//

Text Mined References (262)

PMID Year Title
26565746 2015 Specific Binding of Tetratricopeptide Repeat Proteins to Heat Shock Protein 70 (Hsp70) and Heat Shock Protein 90 (Hsp90) Is Regulated by Affinity and Phosphorylation.
26559972 2016 A Novel Function of Molecular Chaperone HSP70: SUPPRESSION OF ONCOGENIC FOXM1 AFTER PROTEOTOXIC STRESS.
26556859 2015 Combined inhibition of heat shock proteins 90 and 70 leads to simultaneous degradation of the oncogenic signaling proteins involved in muscle invasive bladder cancer.
26446645 2015 Hsp70 Knockdown by siRNA Decreased Collagen Production in Keloid Fibroblasts.
26439956 2015 Heat shock protein 70 (Hsp70) interacts with the Notch1 intracellular domain and contributes to the activity of Notch signaling in myelin-reactive CD4 T cells.
26286954 2015 The joining of the Hsp90 and Hsp70 chaperone cycles yields transient interactions and stable intermediates: insights from mass spectrometry.
26246424 2015 HBP21, a chaperone of heat shock protein 70, functions as a tumor suppressor in hepatocellular carcinoma.
26183779 2015 Tag7 (PGLYRP1) in Complex with Hsp70 Induces Alternative Cytotoxic Processes in Tumor Cells via TNFR1 Receptor.
26165468 2015 Heat shock protein-70 neutralizes apoptosis inducing factor in Bcr/Abl expressing cells.
26050647 2015 Quercetin Enhances Chemosensitivity to Gemcitabine in Lung Cancer Cells by Inhibiting Heat Shock Protein 70 Expression.
More...