Property Summary

NCBI Gene PubMed Count 276
PubMed Score 8635.13
PubTator Score 3498.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Muscular Dystrophy, Facioscapulohumeral 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (22)

Disease log2 FC p
diabetes mellitus -1.100 1.1e-03
adrenocortical carcinoma 1.154 1.6e-02
atypical teratoid / rhabdoid tumor 1.300 6.8e-05
cystic fibrosis -1.109 1.2e-04
ependymoma -1.100 3.5e-02
Gaucher disease type 1 -1.600 2.2e-02
glioblastoma 1.400 1.6e-03
group 3 medulloblastoma 1.100 3.9e-03
lung adenocarcinoma 1.095 7.7e-06
lung cancer 1.100 3.5e-03
medulloblastoma, large-cell 1.400 1.7e-04
Multiple myeloma 1.598 6.6e-04
non primary Sjogren syndrome sicca 1.100 2.5e-02
non-small cell lung cancer 1.180 1.6e-09
oligodendroglioma 1.200 6.9e-03
osteosarcoma 1.702 3.0e-03
ovarian cancer 1.100 3.2e-03
pediatric high grade glioma -1.100 3.9e-05
Pick disease 1.400 4.6e-03
psoriasis 1.100 1.9e-07
subependymal giant cell astrocytoma 1.778 5.1e-03
Waldenstrons macroglobulinemia 1.222 3.4e-03

 GO Function (1)

Gene RIF (267)

AA Sequence

MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRF      1 - 70
HGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDC     71 - 140
VVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQV    141 - 210
SVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSAN    211 - 280
ASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAV    281 - 350
KEKISKFFGKELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF    351 - 420
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIF    421 - 490
SVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKK    491 - 560
MDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENEGKMIMQDKLEKERNDAKNAVEEYVYEMRD    561 - 630
KLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFE    631 - 700
ELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEA    701 - 770
KIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID    771 - 840
//

Text Mined References (287)

PMID Year Title