Property Summary

NCBI Gene PubMed Count 107
PubMed Score 38.86
PubTator Score 45.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 7.5e-07

Synonym

Accession P34931 A6NNB0 B0UXW8 O75634 Q2HXR3 Q8NE72 Q96QC9 Q9UQM1 Heat shock 70 kDa protein 1L
Symbols HSP70T
hum70t
HSP70-1L
HSP70-HOM

Gene

PDB

3GDQ  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (83)

AA Sequence

MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVF      1 - 70
DAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHP     71 - 140
VTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVS    141 - 210
ILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSST    211 - 280
QANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQR    281 - 350
LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS    351 - 420
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNV    421 - 490
TATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGL    491 - 560
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGR    561 - 630
PATGPTIEEVD                                                               631 - 641
//

Text Mined References (110)

PMID Year Title