Property Summary

NCBI Gene PubMed Count 101
Grant Count 9
Funding $552,274.75
PubMed Score 37.56
PubTator Score 45.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 0.000

Gene RIF (82)

PMID Text
26745065 Polymorphism of HSPA1L gene is associated with the development of esophageal Carcinoma.
26496868 HSPA1L (rs2227956) is associated with a decreased risk of idiopathic pulmonary fibrosis in a Mexican population.
26160076 Infertility in males with normal sperm parameters was not significantly associated with HSPA1L:c.1478C>T gene polymorphism.
25680846 may be a predictive biomarker for chronic graft-versus-host disease following allogeneic stem cell transplantation
25044062 HSP70-hom polymorphisms modify the association of diethylhexyl phthalates exposure with insulin resistance.
24051039 findings show polymorphisms of HSP70 genes are associated with the development of gastric cancer and duodenal ulcers in a population at high risk for gastric cancer in Costa Rica
23893339 The potential implication of HSPA1A +190G/C, HSPA1B +1267A/G, and HSPA1L +2437T/C polymorphisms in the susceptibility to paranoid schizophrenia in a homogenous Caucasian Polish population, was analyzed.
23666708 In HSPA1L T2437C polymorphisms, there was no significant differences in frequencies of the variant homozygous in patients compared to controls.
23490384 The risk for the development of chronic hepatitis and hepatocellular carcinoma compared to healthy controls irrespective of the aetiology was significant in terms of the HSPA1B marker than HSPA1L in the Indian population.
23330093 studied the relationship between blood levels of HSP70 and HSP90 and genotypes of HSP70, GSTT1, and GSTM1 polymorphic variants in individuals chronically exposed to mercury
More...

AA Sequence

MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVF      1 - 70
DAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHP     71 - 140
VTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVS    141 - 210
ILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSST    211 - 280
QANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQR    281 - 350
LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS    351 - 420
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNV    421 - 490
TATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGL    491 - 560
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGR    561 - 630
PATGPTIEEVD                                                               631 - 641
//

Text Mined References (103)

PMID Year Title
26745065 2015 Polymorphisms in Heat Shock Proteins A1B and A1L (HOM) as Risk Factors for Oesophageal Carcinoma in Northeast India.
26496868 2015 Analysis of heat shock protein 70 gene polymorphisms Mexican patients with idiopathic pulmonary fibrosis.
26160076 2015 Genetic polymorphisms of hspa1b and hspa1l in infertile men.
25680846 2015 Elevated level of HSPA1L mRNA correlates with graft-versus-host disease.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25044062 2014 HSP70-hom gene polymorphisms modify the association of diethylhexyl phthalates with insulin resistance.
24837172 2015 Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24051039 2013 Polymorphisms in genes coding for HSP-70 are associated with gastric cancer and duodenal ulcer in a population at high risk of gastric cancer in Costa Rica.
More...