Property Summary

NCBI Gene PubMed Count 27
PubMed Score 79.30
PubTator Score 33.66

Knowledge Summary

Patent (11,176)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.0e-06
ependymoma 1.300 4.0e-07
glioblastoma 1.300 6.5e-08
group 3 medulloblastoma 1.800 2.0e-04
lung adenocarcinoma 1.154 1.2e-06
medulloblastoma, large-cell 1.400 9.8e-05
osteosarcoma 1.114 8.2e-04
ovarian cancer -1.600 3.3e-05
pediatric high grade glioma 1.100 7.3e-05
primitive neuroectodermal tumor 1.100 2.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (17)

AA Sequence

MRGAARLGRPGRSCLPGPALRAAAAPALLLARCAVAAAAGLRAAARPRPPELQSASAGPSVSLYLSEDEV      1 - 70
RRLIGLDAELYYVRNDLISHYALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQ     71 - 140
GEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRT    141 - 210
IYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHNMKRIELDDSISASSSSQGLSQPSTQTTQY    211 - 280
LRADTPNNATPITSYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEK    281 - 350
DPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFL    351 - 420
RQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFPM    421 - 490
DYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQ    491 - 560
PINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV                              561 - 604
//

Text Mined References (29)

PMID Year Title