Property Summary

NCBI Gene PubMed Count 25
PubMed Score 75.55
PubTator Score 33.66

Knowledge Summary

Patent (11,176)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 9.15862039890828E-11
ependymoma 2514 3.22393154624047E-9
sonic hedgehog group medulloblastoma 1482 2.88274227271349E-8
glioblastoma 5572 6.45122631702429E-8
osteosarcoma 7933 3.71627512808978E-7
lung adenocarcinoma 2714 1.21018443787722E-6
ovarian cancer 8492 3.336883625956E-5
pediatric high grade glioma 2712 6.37763670340612E-5
medulloblastoma, large-cell 6234 9.84780799668848E-5
primitive neuroectodermal tumor 3031 1.96553265002375E-4
Disease Target Count Z-score Confidence
Robinow syndrome 12 4.707 2.4

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.579 0.000
ependymoma 1.500 0.000
glioblastoma 1.300 0.000
sonic hedgehog group medulloblastoma 2.100 0.000
atypical teratoid/rhabdoid tumor 1.800 0.000
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.200 0.000
pediatric high grade glioma 1.200 0.000
lung adenocarcinoma 1.154 0.000
ovarian cancer -1.600 0.000

Synonym

Accession P34925 Q04696
Symbols JTK5
RYK1
JTK5A
D3S3195

Gene

RYK

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (14)

PMID Text
26596412 results corroborated previous findings of Ryk-mediated Wnt5a effect, and suggested a role for Ror2 in the Wnt5a machinery in glioblastoma
26025956 Early treatment with HGF/IgG complexes after myocardial ischaemia with reperfusion may rescue tissue through vasoprotection conferred by c-Met and RYK signalling
24960609 Ryk-intracellular domain pathway may impair FOXO protective activity in mutant polyglutamine neurons, suggesting neurons unable to efficiently maintain function and resist disease from the earliest phases of the pathogenic process in Huntington disease
24621529 The Ryk is important for the Wnt-5a-dependent induction of MMP-2 and invasive activity in glioma-derived cells and that Ryk might have a novel patho-physiological function in adult cancer invasion.
23748645 is a candidate wnt5a receptor.
22773843 RYK and VANGL2 proteins form a complex, whereas RYK also activated RhoA, a downstream effector of PCP signaling.
21875946 RYK interacts both physically and functionally with the E3 ubiquitin MIB1. MIB1 is sufficient to activate Wnt/CTNNB1 signaling and this activity depends on endogenous RYK.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19937600 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRGAARLGRPGRSCLPGPALRAAAAPALLLARCAVAAAAGLRAAARPRPPELQSASAGPSVSLYLSEDEV      1 - 70
RRLIGLDAELYYVRNDLISHYALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQ     71 - 140
GEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRT    141 - 210
IYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHNMKRIELDDSISASSSSQGLSQPSTQTTQY    211 - 280
LRADTPNNATPITSYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEK    281 - 350
DPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFL    351 - 420
RQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFPM    421 - 490
DYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQ    491 - 560
PINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV                              561 - 604
//

Text Mined References (27)

PMID Year Title
26596412 2015 Wnt5a, Ryk and Ror2 expression in glioblastoma subgroups.
26025956 2015 Human epicardial cell-conditioned medium contains HGF/IgG complexes that phosphorylate RYK and protect against vascular injury.
24960609 2014 The Wnt receptor Ryk reduces neuronal and cell survival capacity by repressing FOXO activity during the early phases of mutant huntingtin pathogenicity.
24621529 2014 Ryk is essential for Wnt-5a-dependent invasiveness in human glioma.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23748645 2014 Immunoreactivity of Wnt5a, Fzd2, Fzd6, and Ryk in glioblastoma: evaluative methodology for DAB chromogenic immunostaining.
22773843 2012 The Wnt receptor Ryk plays a role in mammalian planar cell polarity signaling.
21875946 2011 Mindbomb 1, an E3 ubiquitin ligase, forms a complex with RYK to activate Wnt/?-catenin signaling.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
More...