Property Summary

Ligand Count 1,370
NCBI Gene PubMed Count 118
PubMed Score 349.09
PubTator Score 390.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Dental caries 164 0.0 2.1

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.649 1.5e-04
atypical teratoid / rhabdoid tumor 1.300 2.4e-03
colon cancer -1.200 8.6e-04
cutaneous lupus erythematosus -1.100 5.9e-03
ependymoma 1.400 3.6e-06
inflammatory breast cancer -1.800 1.9e-02
interstitial cystitis -1.100 6.1e-04
intraductal papillary-mucinous carcinoma... -1.500 9.0e-03
intraductal papillary-mucinous neoplasm ... -1.700 1.8e-02
lung carcinoma 2.400 2.4e-33
osteosarcoma -1.186 8.7e-03
ovarian cancer -1.900 3.2e-09
pancreatic cancer -1.200 3.3e-04
pancreatic ductal adenocarcinoma liver m... -1.618 6.5e-03
psoriasis -1.500 3.5e-04
sarcoidosis -1.100 5.1e-03
tuberculosis 1.600 5.2e-05
ulcerative colitis -1.700 1.8e-05

Synonym

Accession P34913 B2Z3B1 B3KTU8 B3KUA0 G3V134 J3KPH7 Q16764 Q9HBJ1 Q9HBJ2
Symbols CEH
SEH

Gene

PANTHER Protein Class (3)

PDB

1S8O   1VJ5   1ZD2   1ZD3   1ZD4   1ZD5   3ANS   3ANT   3I1Y   3I28   3KOO   3OTQ   3PDC   3WK4   3WK5   3WK6   3WK7   3WK8   3WK9   3WKA   3WKB   3WKC   3WKD   3WKE   4C4X   4C4Y   4C4Z   4HAI   4J03   4JNC   4OCZ   4OD0   4X6X   4X6Y   4Y2J   4Y2P   4Y2Q   4Y2R   4Y2S   4Y2T   4Y2U   4Y2V   4Y2X   4Y2Y   5AHX   5AI0   5AI4   5AI5   5AI6   5AI8   5AI9   5AIA   5AIB   5AIC   5AK3   5AK4   5AK5   5AK6   5AKE   5AKG   5AKH   5AKI   5AKJ   5AKK   5AKL   5AKX   5AKY   5AKZ   5ALD   5ALE   5ALF   5ALG   5ALH   5ALI   5ALJ   5ALK   5ALL   5ALM   5ALN   5ALO   5ALP   5ALQ   5ALR   5ALS   5ALT   5ALU   5ALV   5ALW   5ALX   5ALY   5ALZ   5AM0   5AM1   5AM2   5AM3   5AM4   5AM5   5FP0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (95)

AA Sequence

MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEEN      1 - 70
CRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLM     71 - 140
CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTAL    141 - 210
KELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPA    211 - 280
LAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE    281 - 350
RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH    351 - 420
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALM    421 - 490
VTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM         491 - 555
//

Text Mined References (128)

PMID Year Title