Property Summary

NCBI Gene PubMed Count 110
Grant Count 49
R01 Count 25
Funding $8,131,572.12
PubMed Score 305.09
PubTator Score 390.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P34913 B2Z3B1 B3KTU8 B3KUA0 G3V134 J3KPH7 Q16764 Q9HBJ1 Q9HBJ2
Symbols CEH
SEH

Gene

PANTHER Protein Class (3)

PDB

1S8O   1VJ5   1ZD2   1ZD3   1ZD4   1ZD5   3ANS   3ANT   3I1Y   3I28   3KOO   3OTQ   3PDC   3WK4   3WK5   3WK6   3WK7   3WK8   3WK9   3WKA   3WKB   3WKC   3WKD   3WKE   4C4X   4C4Y   4C4Z   4HAI   4J03   4JNC   4OCZ   4OD0   4X6X   4X6Y   4Y2J   4Y2P   4Y2Q   4Y2R   4Y2S   4Y2T   4Y2U   4Y2V   4Y2X   4Y2Y   5AHX   5AI0   5AI4   5AI5   5AI6   5AI8   5AI9   5AIA   5AIB   5AIC   5AK3   5AK4   5AK5   5AK6   5AKE   5AKG   5AKH   5AKI   5AKJ   5AKK   5AKL   5AKX   5AKY   5AKZ   5ALD   5ALE   5ALF   5ALG   5ALH   5ALI   5ALJ   5ALK   5ALL   5ALM   5ALN   5ALO   5ALP   5ALQ   5ALR   5ALS   5ALT   5ALU   5ALV   5ALW   5ALX   5ALY   5ALZ   5AM0   5AM1   5AM2   5AM3   5AM4   5AM5   5FP0  

 GWAS Trait (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
707 screening 310 / 0 / 90339 Novel sEH inhibitors for the therapeutic treatment of hypertension and inflammation
717 screening 38 / 0 / 90611 Novel sEH activators for the therapeutic treatment of hypertension and inflammation
1026 confirmatory 44 / 0 / 257 sEH_DR_Inh_Infinite200_Fluorescence_01072008

Gene RIF (88)

PMID Text
26976569 Increased levels of soluble epoxide hydrolase in the brain of depressed patients
26453326 Suggest role for Ephx2 in vascular smooth muscle phenotypic modulation and migration in the development of atherosclerosis.
26341485 Within the EPHX2 promoter -56/+32, five Sp1-binding sites were identified, and the mutation of each of these sites showed that the first one (SP1_1) was important in both suppression by Sp1 and activation by AP2alpha.
26230946 carriers of rs1042032 GG genotype had lower estimated glomerular filtration rate and higher serum creatinine values 1 year after grafting compared to patients carrying wildtype A-allele; this GG genotype also associated to increased risk of acute rejection; results suggest genetic variability in EPHX2 may have an impact on outcome of deceased-donor renal transplantation
25966114 Essential hypertension is associated with the rs751141 G/A allele gene polymorphism in EPHX2 in Han subjects but not in Kazakh and Uygur subjects.
25947240 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke.
25839935 Results show that CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction confers a significantly higher risk for ischemic stroke.
25659109 Potent natural soluble epoxide hydrolase inhibitors from Pentadiplandra brazzeana baillon: synthesis, quantification, and measurement of biological activities in vitro and in vivo.
25388680 Patients with CYP2C8*2C and EPHX2 404del variants had worse long-term outcomes while those with EPHX2 287Gln, CYP2J2*7, and CYP2C9 g.816G variants had favorable outcomes.
25216066 Genetic polymorphisms of soluble EH are associated with neurological and vital outcomes after aneurysmal subarachnoid hemorrhage.
More...

AA Sequence

MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEEN      1 - 70
CRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLM     71 - 140
CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTAL    141 - 210
KELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPA    211 - 280
LAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE    281 - 350
RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH    351 - 420
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALM    421 - 490
VTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM         491 - 555
//

Text Mined References (120)

PMID Year Title
26976569 2016 Gene deficiency and pharmacological inhibition of soluble epoxide hydrolase confers resilience to repeated social defeat stress.
26453326 2015 Soluble epoxide hydrolase is involved in the development of atherosclerosis and arterial neointima formation by regulating smooth muscle cell migration.
26341485 2015 Down-regulation of EPHX2 gene transcription by Sp1 under high-glucose conditions.
26230946 2015 A 3'-UTR Polymorphism in Soluble Epoxide Hydrolase Gene Is Associated with Acute Rejection in Renal Transplant Recipients.
25966114 2015 Relationship between EPHX2 gene polymorphisms and essential hypertension in Uygur, Kazakh, and Han.
25947240 2015 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke in Chinese Populations.
25839935 2015 CYP2C8 rs17110453 and EPHX2 rs751141 two-locus interaction increases susceptibility to ischemic stroke.
25659109 2015 Potent natural soluble epoxide hydrolase inhibitors from Pentadiplandra brazzeana baillon: synthesis, quantification, and measurement of biological activities in vitro and in vivo.
25388680 2015 Genetic markers in the EET metabolic pathway are associated with outcomes in patients with aneurysmal subarachnoid hemorrhage.
25216066 2014 Genetic variation in soluble epoxide hydrolase: association with outcome after aneurysmal subarachnoid hemorrhage.
More...