Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.22
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Multiple myeloma 1.825 0.001
malignant mesothelioma -1.100 0.000
cutaneous lupus erythematosus 2.100 0.016
psoriasis 2.100 0.000
glioblastoma 2.300 0.002
cystic fibrosis 1.592 0.000
astrocytoma 1.800 0.036
periodontitis 1.500 0.000
primitive neuroectodermal tumor 1.200 0.045
non-small cell lung cancer -1.875 0.000
lung cancer -2.800 0.000
active Crohn's disease 1.030 0.018
ulcerative colitis 3.300 0.000
interstitial cystitis 1.900 0.009
adult high grade glioma 2.100 0.002
pilocytic astrocytoma 2.400 0.000
posterior fossa group B ependymoma 1.200 0.001
primary Sjogren syndrome 2.900 0.000
subependymal giant cell astrocytoma 2.639 0.021
invasive ductal carcinoma 1.383 0.001
lung adenocarcinoma -1.091 0.008
ovarian cancer -2.100 0.000
head and neck cancer -1.500 0.020

Gene RIF (1)

PMID Text
22082156 Knockdown of ecotropic viral integration site 2B (EVI2B) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MDPKYFILILFCGHLNNTFFSKTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQS      1 - 70
ISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPK     71 - 140
SFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNSIAAILIGV    141 - 210
LLTSMLVAIIIIVLWKCLRKPVLNDQNWAGRSPFADGETPDICMDNIRENEISTKRTSIISLTPWKPSKS    211 - 280
TLLADDLEIKLFESSENIEDSNNPKTEKIKDQVNGTSEDSADGSTVGTAVSSSDDADLPPPPPLLDLEGQ    281 - 350
ESNQSDKPTMTIVSPLPNDSTSLPPSLDCLNQDCGDHKSEIIQSFPPLDSLNLPLPPVDFMKNQEDSNLE    351 - 420
IQCQEFSIPPNSDQDLNESLPPPPAELL                                              421 - 448
//

Text Mined References (15)

PMID Year Title
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2117566 1990 Identification and characterization of transcripts from the neurofibromatosis 1 region: the sequence and genomic structure of EVI2 and mapping of other transcripts.
More...