Property Summary

Ligand Count 74
NCBI Gene PubMed Count 48
PubMed Score 32.93
PubTator Score 36.27

Knowledge Summary

Patent (1,104)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count
Thyrotoxic periodic paralysis 3

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.0e-02
ependymoma -1.500 2.4e-02
glioblastoma -1.300 2.7e-03
group 3 medulloblastoma -1.400 2.3e-02
lung cancer 1.600 8.7e-04
medulloblastoma, large-cell -1.400 1.9e-02

Gene RIF (37)

AA Sequence

MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRI      1 - 70
LDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNN     71 - 140
LLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFG    141 - 210
SYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVI    211 - 280
QTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVF    281 - 350
SALIEFATVNYFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA    351 - 420
APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVNRESAIKGMIR    421 - 490
KQ                                                                        491 - 492
//

Text Mined References (48)

PMID Year Title