Property Summary

NCBI Gene PubMed Count 48
PubMed Score 240.35
PubTator Score 52.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.200 3.9e-02
adrenocortical carcinoma 1.117 6.0e-03
astrocytoma 1.200 1.4e-15
Atopic dermatitis 1.100 2.5e-03
Breast cancer 1.400 8.9e-07
colon cancer 1.500 3.0e-05
diabetes mellitus -1.100 3.0e-03
glioblastoma 1.100 9.3e-06
group 3 medulloblastoma 1.100 6.8e-03
lung adenocarcinoma 1.747 1.8e-06
lung cancer 2.200 1.1e-02
medulloblastoma, large-cell 1.500 8.6e-04
Multiple myeloma 1.212 2.7e-02
nasopharyngeal carcinoma 1.200 3.1e-03
non primary Sjogren syndrome sicca 1.100 4.0e-02
non-small cell lung cancer 1.558 2.7e-22
oligodendroglioma 1.100 3.3e-14
osteosarcoma -1.946 8.2e-04
ovarian cancer 1.500 2.1e-05
pancreatic ductal adenocarcinoma liver m... -1.479 7.9e-03
pediatric high grade glioma 1.300 4.6e-06
posterior fossa group A ependymoma 1.300 2.1e-08
psoriasis -2.000 5.3e-04

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRG      1 - 70
LELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQP     71 - 140
YSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLA    141 - 210
LTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHK    211 - 280
TLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREY    281 - 350
SLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT    351 - 420
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVE    421 - 490
QFARAFPMPGFDEH                                                            491 - 504
//

Text Mined References (55)

PMID Year Title