Property Summary

NCBI Gene PubMed Count 43
Grant Count 8
R01 Count 4
Funding $416,798.9
PubMed Score 231.67
PubTator Score 52.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Multiple myeloma 1.212 0.027
psoriasis -2.000 0.001
astrocytoma 1.200 0.000
glioblastoma 1.800 0.000
oligodendroglioma 1.600 0.000
osteosarcoma -1.946 0.001
sonic hedgehog group medulloblastoma 2.100 0.000
medulloblastoma, large-cell 1.700 0.002
Atopic dermatitis 1.100 0.003
adrenocortical carcinoma 1.167 0.005
pancreatic ductal adenocarcinoma liver m... -1.479 0.008
non-small cell lung cancer 2.104 0.000
lung cancer 2.400 0.000
colon cancer 1.600 0.000
diabetes mellitus -1.100 0.003
pediatric high grade glioma 1.800 0.000
posterior fossa group A ependymoma 1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.040
nasopharyngeal carcinoma 1.200 0.003
lung adenocarcinoma 1.747 0.000
acute myeloid leukemia -1.200 0.039
ovarian cancer 2.100 0.000
Breast cancer 1.400 0.000

Gene RIF (15)

PMID Text
26975021 High SHMT2 expression increases glycine-dependent nucleotide synthesis leading to bladder cancer growth.
26103880 The SHMT-2 is the direct targets of miR-370 and miR-373, respectively, in human articular chondrocytes.
25855294 SHMT2 is required for glioblastoma multiforme cells to adapt to the tumour environment, but also renders these cells sensitive to glycine cleavage system inhibition
25619277 SHMT1 exists in solution as a tetramer, both in the absence and presence of PLP, while SHMT2 undergoes a dimer-to-tetramer transition.
22220685 The present study not only describes individual genetic variation that directly affects SHMT1 and SHMT2 activity, but provided insight into the overall regulation of the Folate and Methionine Cycles.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19513116 SHMT1 and SHMT2 are functionally redundant in nuclear de novo thymidylate biosynthesis
19086053 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRG      1 - 70
LELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQP     71 - 140
YSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLA    141 - 210
LTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHK    211 - 280
TLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREY    281 - 350
SLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT    351 - 420
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVE    421 - 490
QFARAFPMPGFDEH                                                            491 - 504
//

Text Mined References (50)

PMID Year Title
26975021 2016 Metabolic phenotype of bladder cancer.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26103880 2015 miR-370 and miR-373 regulate the pathogenesis of osteoarthritis by modulating one-carbon metabolism via SHMT-2 and MECP-2, respectively.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902260 2015 Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment.
25855294 2015 SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance.
25619277 2015 How pyridoxal 5'-phosphate differentially regulates human cytosolic and mitochondrial serine hydroxymethyltransferase oligomeric state.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...