Property Summary

NCBI Gene PubMed Count 121
Grant Count 63
R01 Count 47
Funding $9,737,089.48
PubMed Score 360.25
PubTator Score 153.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P34896 B4DPM9 D3DXD0 Q96HY0 Q9UMD1 Q9UMD2 SHMT
Symbols SHMT
CSHMT

Gene

PANTHER Protein Class (2)

PDB

1BJ4  

Gene RIF (105)

PMID Text
26316272 an association between MTRR 66 and SHMT1 1420 polymorphisms and spaceflight-induced vision changes
26125758 our meta-analysis suggested that the SHMT1 C1420T polymorphism was associated with decreased risk of breast cancer.
25619277 SHMT1 exists in solution as a tetramer, both in the absence and presence of PLP, while SHMT2 undergoes a dimer-to-tetramer transition.
25412303 SHMT1 knockdown in lung cancer cells leads to cell cycle arrest and to p53-dependent apoptosis.
25194438 In this meta-analysis, SHMT1 C1420T polymorphism did not have a significant association with the risk of cancer overall.
24789272 found evidence for association of SHMT1 C1420T polymorphism with significantly reduced risk of breast cancer in Asians
24716966 SHMT1 C1420T polymorphism is not associated with overall cancer development.
24641398 serine hydroxymethyltransfarase C1420T reduces risk for both acute lymphoblastic leukemia and acute myeloid leukemia and influences disease progression in acute lymphoblastic leukemia
24362509 SHMT1 C1420T and DNMT3B C46359T polymorphisms are not associated with HNC development in Brazilian population, however, SHMT1 C1420T polymorphism is less frequent in patients with primary site of tumor in larynx
23474074 The link between mitochondrial serine hydroxymethyltransferase activity and heme biosynthesis represents an important aspect of the whole picture of cancer cell metabolism.
More...

AA Sequence

MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN      1 - 70
NKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG     71 - 140
LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLE    141 - 210
YARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKT    211 - 280
GKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIV    281 - 350
TGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK    351 - 420
VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF           421 - 483
//

Text Mined References (127)

PMID Year Title
26316272 2016 Genotype, B-vitamin status, and androgens affect spaceflight-induced ophthalmic changes.
26125758 2015 Clinical significance of SHMT1 rs1979277 polymorphism in Asian solid tumors: evidence from a meta-analysis.
25619277 2015 How pyridoxal 5'-phosphate differentially regulates human cytosolic and mitochondrial serine hydroxymethyltransferase oligomeric state.
25416956 2014 A proteome-scale map of the human interactome network.
25412303 2014 SHMT1 knockdown induces apoptosis in lung cancer cells by causing uracil misincorporation.
25194438 2014 Association between cytosolic serine hydroxymethyltransferase (SHMT1) gene polymorphism and cancer risk: a meta-analysis.
24789272 2014 Polymorphism of cytosolic serine hydroxymethyltransferase and breast cancer risk: evidence from a meta-analysis.
24716966 2014 C1420T polymorphism of cytosolic serine hydroxymethyltransferase and risk of cancer: a meta-analysis.
24698160 2014 Distinct biochemical properties of human serine hydroxymethyltransferase compared with the Plasmodium enzyme: implications for selective inhibition.
24641398 2014 Association of thymidylate synthase 5'-UTR 28bp tandem repeat and serine hydroxymethyltransfarase C1420T polymorphisms with susceptibility to acute leukemia.
More...