Property Summary

NCBI Gene PubMed Count 127
PubMed Score 370.40
PubTator Score 153.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.6e-05
ductal carcinoma in situ -1.900 2.0e-05
esophageal adenocarcinoma -1.500 3.2e-02
invasive ductal carcinoma -1.300 7.4e-03
medulloblastoma, large-cell 1.400 3.6e-04
nephrosclerosis -1.427 7.6e-03
pancreatic ductal adenocarcinoma liver m... -1.812 7.7e-03
psoriasis 1.300 3.5e-03

Protein-protein Interaction (3)

Gene RIF (111)

AA Sequence

MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN      1 - 70
NKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG     71 - 140
LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLE    141 - 210
YARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKT    211 - 280
GKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIV    281 - 350
TGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK    351 - 420
VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF           421 - 483
//

Text Mined References (133)

PMID Year Title