Property Summary

NCBI Gene PubMed Count 16
Grant Count 13
R01 Count 5
Funding $284,819.17
PubMed Score 115.64
PubTator Score 48.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 0.006
pilocytic astrocytoma 1.900 0.000
ulcerative colitis -1.200 0.000

Gene RIF (7)

PMID Text
25176058 Study found that BMP8B was downregulated in pancreatic cancer tissues and BMP8B mediates the survival of pancreatic cancer cells and regulates the progression of pancreatic cancer.
24076131 Five novel SNPs within BMP8B gene.Genetic variants in BMP8B gene are associated with growth traits in Chinese native cattle.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16314833 Epigenetic silencing of the bone morphogenetic protein 2 gene through methylation is associated with gastric carcinomas
15063762 Observational study of gene-disease association. (HuGE Navigator)
9070944 Reports on the mouse homolog of this gene.

AA Sequence

MTALPGPLWLLGLALCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLP      1 - 70
ASAPLFMLDLYHAMAGDDDEDGAPAERRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGEA     71 - 140
VTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLKR    141 - 210
HKDLGLRLYVETEDGHSVDPGLAGLLGQRAPRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELP    211 - 280
QANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAIL    281 - 350
QSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH                      351 - 402
//

Text Mined References (17)

PMID Year Title
25401122 2014 Bone Morphogenetic Protein (BMP) signaling in development and human diseases.
25176058 2014 BMP8B mediates the survival of pancreatic cancer cells and regulates the progression of pancreatic cancer.
24076131 2013 Genetic variants in BMP8B gene are associated with growth traits in Chinese native cattle.
22579288 2012 BMP8B increases brown adipose tissue thermogenesis through both central and peripheral actions.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16314833 2006 Frequent epigenetic silencing of the bone morphogenetic protein 2 gene through methylation in gastric carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...