Property Summary

NCBI Gene PubMed Count 17
PubMed Score 120.12
PubTator Score 48.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ulcerative colitis 1819 1.3e-07
Astrocytoma, Pilocytic 3081 3.2e-07
glioblastoma 5792 5.9e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.900 3.2e-07
glioblastoma 1.100 5.9e-03
ulcerative colitis -1.200 1.3e-07

Gene RIF (8)

AA Sequence

MTALPGPLWLLGLALCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLP      1 - 70
ASAPLFMLDLYHAMAGDDDEDGAPAERRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGEA     71 - 140
VTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLKR    141 - 210
HKDLGLRLYVETEDGHSVDPGLAGLLGQRAPRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELP    211 - 280
QANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAIL    281 - 350
QSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH                      351 - 402
//

Text Mined References (18)

PMID Year Title