Property Summary

NCBI Gene PubMed Count 57
PubMed Score 3279.73
PubTator Score 2234.84

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (45)

PMID Text
27442380 Using double labeling with Iba-1 and cd68 could determine the physiological state of microglia in brain contusion based on their morphology and immunoreactivity.
27065104 Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25666753 we raised a possibility that the microlocalization of CD68(+) tumor-associated macrophages was an indispensable factor for the advance of oral squamous cell carcinoma.
25204373 This study does not support a prognostic role of CD68 positivity in predicting survival.
25098425 Microenvironment CD20 + cells seem to play a favorable prognostic role in classical Hodgkin Lymphoma. Depletion of CD20 + cells together with an increase of TAMs identifies a group of patients with high-risk disease.
25030063 The human CD68 promoter drives green fluorescent protein expression in all CD115(+) monocytes of adult blood, spleen, and bone marrow.
24794251 Data indicate that the high CD68/CD3 ratio identifies a bad prognosis group among muscle-invasive urothelial carcinoma (UC).
24766492 Data indicate the prognostic value of CD68 antigen in Hodgkin lymphoma (HL).
24459672 the distribution of CD68-positive cells during normal brain development may not reflect a supportive role of these microglia in axonogenesis of midterm human fetuses.
24067108 CD68 tumor-associated macrophage marker is not prognostic of clinical outcome in classical Hodgkin lymphoma.
23951013 The MRC1/CD68 ratio is positively associated with adipose tissue lipogenesis and with muscle mitochondrial gene expression in humans.
23727038 Rhinovirus colocalizes with CD68- and CD11b-positive macrophages following experimental infection in humans.
23555776 CD68 has a role in poor recurrence-free survival of hepatocellular carcinoma, but CD163 is more related to active hepatitis
23549871 Follicular lymphoma patients with PSMB1 P11A (G allele) and low CD68 expression have significantly longer progression free survival with bortezomib-rituximab versus rituximab.
23289476 Multivariate analysis identified the density of CD163-positive cells as well as the ratio of CD163/CD68 expression as negative predictors for survival of epithelial ovarian cancer patients.
23275124 The CD68-positive cells (those that have not yet developed into foam cells) present in the intima of saphenous vein grafts might serve as a very early marker of graft occlusion.
23241402 Suggest that the proteins or mRNAs expressed by the proinflammatory CD68(+)MR(-) macrophages may contribute to abdominal aortic aneurysm pathology.
22968485 After bed rest, CD68 expression was increased in LBW (P=0.03) but not in NBW individuals.
22955918 CSF1R and cd68 gene expression is an independent predictor for progression-free survival of Hodgkin lymphoma patients.
22948049 Increased CD68 expression was associated with Hodgkin lymphoma
22667341 the marker CD68 might accurately predict early outcome of de novo cHL and could be used in combination with c-kit and TiA1 staining.
22395501 CD68 may have a role in atherosclerotic plaque
22314623 elderly subjects had twofold higher CD68 and CD206 gene expression (both P < 0.002) than young participants. In both studies, CD68(+) muscle macrophages were not associated with BMI.
22289504 CD163 staining is lower than CD68, with less non-specific staining of background inflammatory cells and Hodgkin cells, therefore is a better marker for Hodgkin lymphoma associated macrophages.
22163030 Statins promote the beneficial remodeling of plaques in diseased mouse arteries through the stimulation of the CCR7 / CD68 emigration pathway in macrophages
22044760 CD68 and CD163 are prognostic factors for Korean patients with Hodgkin lymphoma
22007938 In the intratumoral and peritumoral areas, the expression of CD1a, tryptase, and CD68 was significantly higher in papillary thyroid carcinoma than in thyroid adenomas.
21980389 Results show that levels of CD3epsilon, CD25, CD68, and ICAM-1 mRNA in BCC biopsies may predict risk for new basal cell carcinomas.
21266828 Increased numbers of CD68-positive tumor macrophages indicate an adverse overall outcome in Hodgkin lymphoma.
21192298 Data show that the number of TNF-alpha and CD68 positive cells in HIZ was significantly higher than that in the annulus fibrosus around HIZ and in the control.
21113139 Fibrolamellar carcinomas are positive for CD68.
20374310 Treatment with etanercept may be involved in vascular and cell proliferations with inhibition of the expression of CD68 and MMP-3 in synovium of rheumatoid arthritis patients.
20333725 Significant co-localization of CD36 receptor with cells of the macrophage lineage, such as CD68 positive cells.
19661345 High CD68 and kallikrein 6 expression is associated with glioma progression.
19356953 Expression of t-PA, PAI-1, TF, TFPI, TM, CD68 and VE-cadherin were significantly increased in the early symptomatic group, but the level of gene expression in the late symptomatic group was indistinguishable from the asymptomatic group.
19165649 These results suggest that MMP-3 and CD68 cells may play an important role in the pathogenesis of synovial inflammation in ankylosing spondylitis.
18316565 High-level expression of CD68 is associated with leiomyosarcomas
17583472 human CD68 gene expression is associated with changes in Pol II phosphorylation and short-range intrachromosomal gene looping
17052752 A marker that may be used to detect macrophages and in the anatomical plane of the fetomaternal junction.
16888915 The specificity of CD68 expression in fibroblasts was verified by RT-PCR which also showed some tumor cell types to express CD68 mRNA.
15638380 The expression of CD68 was statistically significantly higher in the aggressive non hodgkin' lymphoma than in indolent nHL.
15214825 study expands the immunophenotype of granular cell tumor (S100, CD68, protein gene product 9.5, and inhibin-alpha) regardless of location and supports a neural origin
12676954 CD68 expression is down-regulated in lymphoid cells by combinatorial interactions between PU.1 and IRF-4
12397372 CD68 was expressed in beta-cells of NOD mice by 14-17 weeks of age, when a large proportion of these cells were infiltrated with lymphocytes and monocytes.

AA Sequence

MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTT      1 - 70
SHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHP     71 - 140
EPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGA    141 - 210
HPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNS    211 - 280
SIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSA    281 - 350
YQAL                                                                      351 - 354
//

Text Mined References (64)

PMID Year Title
27442380 2015 Visualisation of Microglia with the use of Immunohistochemical Double Staining Method for CD-68 and Iba-1 of Cerebral Tissue Samples in Cases of Brain Contusions.
27065104 2016 A Potential Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression.
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25666753 2015 Microlocalization of CD68+ tumor-associated macrophages in tumor stroma correlated with poor clinical outcomes in oral squamous cell carcinoma patients.
25204373 2015 CD68 staining correlates with the size of residual mass but not with survival in classical Hodgkin lymphoma.
25098425 2015 High CD20+ background cells predict a favorable outcome in classical Hodgkin lymphoma and antagonize CD68+ macrophages.
25030063 2014 Human CD68 promoter GFP transgenic mice allow analysis of monocyte to macrophage differentiation in vivo.
24794251 2014 Infiltration of CD3? and CD68? cells in bladder cancer is subtype specific and affects the outcome of patients with muscle-invasive tumors.
24766492 2015 CD68-positive tumor-associated macrophages predict unfavorable treatment outcomes in classical Hodgkin lymphoma in correlation with interim fluorodeoxyglucose-positron emission tomography assessment.
24459672 2013 Site-specific distribution of CD68-positive microglial cells in the brains of human midterm fetuses: a topographical relationship with growing axons.
24067108 2014 CD68 tumor-associated macrophage marker is not prognostic of clinical outcome in classical Hodgkin lymphoma.
23951013 2013 The MRC1/CD68 ratio is positively associated with adipose tissue lipogenesis and with muscle mitochondrial gene expression in humans.
23727038 2013 Rhinovirus colocalizes with CD68- and CD11b-positive macrophages following experimental infection in humans.
23555776 2013 The clinical significance of the CD163+ and CD68+ macrophages in patients with hepatocellular carcinoma.
23549871 2013 Prespecified candidate biomarkers identify follicular lymphoma patients who achieved longer progression-free survival with bortezomib-rituximab versus rituximab.
23289476 2013 Expression of M2-polarized macrophages is associated with poor prognosis for advanced epithelial ovarian cancer.
23275124 2013 CD68 expression in aortocoronary saphenous vein bypass grafts.
23241402 2013 Role of proinflammatory CD68(+) mannose receptor(-) macrophages in peroxiredoxin-1 expression and in abdominal aortic aneurysms in humans.
22968485 2012 Muscle inflammatory signaling in response to 9 days of physical inactivity in young men with low compared with normal birth weight.
22955918 2012 Gene expression profiling of microdissected Hodgkin Reed-Sternberg cells correlates with treatment outcome in classical Hodgkin lymphoma.
22948049 2012 Tumor-associated macrophages predict inferior outcomes in classic Hodgkin lymphoma: a correlative study from the E2496 Intergroup trial.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22667341 2013 Macrophage, mast cell and T lymphocyte infiltrations are independent predictive biomarkers of primary refractoriness or early relapse in classical Hodgkin lymphoma.
22395501 2012 Immunohistochemical expression of anti-CD68 antibody in atherosclerotic plaque.
22314623 2012 Low macrophage accumulation in skeletal muscle of obese type 2 diabetics and elderly subjects.
22289504 2012 CD163 versus CD68 in tumor associated macrophages of classical Hodgkin lymphoma.
22163030 2011 Statins promote the regression of atherosclerosis via activation of the CCR7-dependent emigration pathway in macrophages.
22044760 2012 CD68 and CD163 as prognostic factors for Korean patients with Hodgkin lymphoma.
22007938 2011 Higher intratumoral expression of CD1a, tryptase, and CD68 in a follicular variant of papillary thyroid carcinoma compared to adenomas: correlation with clinical and pathological parameters.
21980389 2011 Tumor site immune markers associated with risk for subsequent basal cell carcinomas.
21266828 2010 Refined prognostic role of CD68-positive tumor macrophages in the context of the cellular micromilieu of classical Hodgkin lymphoma.
21192298 2011 The expression of tumor necrosis factor-? and CD68 in high-intensity zone of lumbar intervertebral disc on magnetic resonance image in the patients with low back pain.
21113139 2011 Fibrolamellar carcinomas are positive for CD68.
20374310 2009 Histological analysis of synovium by treatment of etanercept for rheumatoid arthritis.
20333725 2010 Molecular signaling operated by a diet-compatible mixture of oxysterols in up-regulating CD36 receptor in CD68 positive cells.
19661345 2009 Prognostic impact of CD68 and kallikrein 6 in human glioma.
19356953 2009 Elevated tissue expression of thrombomodulatory factors correlates with acute symptomatic carotid plaque phenotype.
19165649 Immunohistological features of hip synovitis in ankylosing spondylitis with advanced hip involvement.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18405323 2008 Expression of CD68 in non-myeloid cell types.
18316565 2008 Prognostic significance of macrophage infiltration in leiomyosarcomas.
17583472 2007 Cell-type-specific expression of the human CD68 gene is associated with changes in Pol II phosphorylation and short-range intrachromosomal gene looping.
17052752 Distribution of CD14+ and CD68+ macrophages in the placental bed and basal plate of women with preeclampsia and preterm labor.
16888915 2003 [The "classical" macrophage marker CD68 is strongly expressed in primary human fibroblasts].
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
15647451 2005 CD68 is not a macrophage-specific antigen.
15638380 2004 Macrophage/histiocytic antigen CD68 expression in neoplastic and reactive lymph nodes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15214825 2004 Granular cell tumor: immunohistochemical assessment of inhibin-alpha, protein gene product 9.5, S100 protein, CD68, and Ki-67 proliferative index with clinical correlation.
15194571 2004 Macrophage specificity of three anti-CD68 monoclonal antibodies (KP1, EBM11, and PGM1) widely used for immunohistochemistry and flow cytometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676954 2003 Multiple Ets factors and interferon regulatory factor-4 modulate CD68 expression in a cell type-specific manner.
12572894 2002 Part of CD68+ macrophages in the clearence of apoptotic bodies in human metanephros.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429719 2002 The presence of stomatin in detergent-insoluble domains of neutrophil granule membranes.
12397372 2002 Cellular distribution and contribution of cyclooxygenase COX-2 to diabetogenesis in NOD mouse.
10985244 2000 Permissive factors for HIV-1 infection of macrophages.
9790779 1998 The linked human elongation initiation factor 4A1 (EIF4A1) and CD68 genes map to chromosome 17p13.
8639768 1996 Early ontogeny of the human marrow from long bones: an immunohistochemical study of hematopoiesis and its microenvironment.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7680921 1993 Molecular cloning of CD68, a human macrophage marker related to lysosomal glycoproteins.