Property Summary

NCBI Gene PubMed Count 57
Grant Count 162
R01 Count 76
Funding $18,065,177.02
PubMed Score 3279.73
PubTator Score 2234.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P34810 B4DVT4 Q53HR6 Q53XI3 Q96BI7
Symbols GP110
LAMP4
SCARD1

Gene

Gene RIF (45)

PMID Text
27442380 Using double labeling with Iba-1 and cd68 could determine the physiological state of microglia in brain contusion based on their morphology and immunoreactivity.
27065104 Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25666753 we raised a possibility that the microlocalization of CD68(+) tumor-associated macrophages was an indispensable factor for the advance of oral squamous cell carcinoma.
25204373 This study does not support a prognostic role of CD68 positivity in predicting survival.
25098425 Microenvironment CD20 + cells seem to play a favorable prognostic role in classical Hodgkin Lymphoma. Depletion of CD20 + cells together with an increase of TAMs identifies a group of patients with high-risk disease.
25030063 The human CD68 promoter drives green fluorescent protein expression in all CD115(+) monocytes of adult blood, spleen, and bone marrow.
24794251 Data indicate that the high CD68/CD3 ratio identifies a bad prognosis group among muscle-invasive urothelial carcinoma (UC).
24766492 Data indicate the prognostic value of CD68 antigen in Hodgkin lymphoma (HL).
24459672 the distribution of CD68-positive cells during normal brain development may not reflect a supportive role of these microglia in axonogenesis of midterm human fetuses.
More...

AA Sequence

MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTT      1 - 70
SHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHP     71 - 140
EPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGA    141 - 210
HPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNS    211 - 280
SIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSA    281 - 350
YQAL                                                                      351 - 354
//

Text Mined References (64)

PMID Year Title
27442380 2015 Visualisation of Microglia with the use of Immunohistochemical Double Staining Method for CD-68 and Iba-1 of Cerebral Tissue Samples in Cases of Brain Contusions.
27065104 2016 A Potential Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression.
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25666753 2015 Microlocalization of CD68+ tumor-associated macrophages in tumor stroma correlated with poor clinical outcomes in oral squamous cell carcinoma patients.
25204373 2015 CD68 staining correlates with the size of residual mass but not with survival in classical Hodgkin lymphoma.
25098425 2015 High CD20+ background cells predict a favorable outcome in classical Hodgkin lymphoma and antagonize CD68+ macrophages.
25030063 2014 Human CD68 promoter GFP transgenic mice allow analysis of monocyte to macrophage differentiation in vivo.
24794251 2014 Infiltration of CD3? and CD68? cells in bladder cancer is subtype specific and affects the outcome of patients with muscle-invasive tumors.
24766492 2015 CD68-positive tumor-associated macrophages predict unfavorable treatment outcomes in classical Hodgkin lymphoma in correlation with interim fluorodeoxyglucose-positron emission tomography assessment.
More...