Property Summary

NCBI Gene PubMed Count 117
PubMed Score 138.08
PubTator Score 297.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (89)

AA Sequence

MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTT      1 - 70
SRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF     71 - 140
KRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA             141 - 201
//

Text Mined References (122)

PMID Year Title