Property Summary

NCBI Gene PubMed Count 114
PubMed Score 128.25
PubTator Score 297.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.97650579364766E-12
malignant mesothelioma 3163 3.27743415867313E-10
juvenile dermatomyositis 1189 7.76803903620543E-7
cystic fibrosis 1670 1.10884403126098E-6
Duchenne muscular dystrophy 602 2.32890409230655E-6
ovarian cancer 8492 2.93804001244682E-6
sonic hedgehog group medulloblastoma 1482 4.36975318032863E-6
osteosarcoma 7933 1.55834841876336E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.90857889726013E-5
limb girdle muscular dystrophy 2A 156 2.20453545241556E-5
tuberculosis 1563 2.29245782308769E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.94213870079444E-5
ulcerative colitis 2087 4.34135204552532E-5
Amyotrophic Lateral Sclerosis 432 5.07188994053903E-5
fascioscapulohumeral muscular dystrophy 100 1.62305939380465E-4
pituitary cancer 1972 2.86199234771489E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.03929168721949E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.54588282518327E-4
psoriasis 6685 8.02812436955831E-4
Down syndrome 548 0.00130627927582771
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0015987442230712
Atopic dermatitis 944 0.00183745089171654
nasopharyngeal carcinoma 1056 0.00192737624340053
adrenocortical carcinoma 1427 0.00275815682196934
non primary Sjogren syndrome sicca 840 0.00392984576885194
invasive ductal carcinoma 2950 0.00575989428024896
cutaneous lupus erythematosus 1056 0.00794966496437746
glioblastoma 5572 0.016407537404597
atypical teratoid / rhabdoid tumor 4369 0.0224630345177399
Breast cancer 3099 0.0238523710285762
ductal carcinoma in situ 1745 0.0444502001313967
Disease Target Count Z-score Confidence
Cancer 2346 3.283 1.6

Expression

Synonym

Accession P34741 B3KQA3 Q6PIS6 Q9H6V1 SYND2
Symbols HSPG
CD362
HSPG1
SYND2

Gene

  Ortholog (10)

 GO Function (1)

Gene RIF (88)

PMID Text
26469385 HIV-1 MA interacts with SDC2 in primary hepatocytes
26018157 HIV-1 MA interacts with SDC2 in primary hepatocytes
25916113 In this review we considered the function of syndecan-2, the structure of syndecan-2 and its role in the formation of amyloid plaques.
24956062 Data indicate that the extracellular and cytoplasmic domains of syndecans 1/2/3/4 are intrinsically disordered regions.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24736615 HIV matrix protein p17 is pro-fibrogenic through its interactions both with CXCR2 and syndecan-2 on activated HSCs
24736615 HIV-1 MA interacts with SDC2 in primary hepatocytes
24662262 The results demonstrate the importance of PDZ-binding domain of syndecan-2 for controlling LFA-1 affinity and cell adhesion.
24613844 Taken together, these data suggest that IL-1alpha regulates extracellular domain shedding of syndecan-2 through regulation of the MAP kinase-mediated MMP-7 expression in colon cancer cells.
24472179 SDC2 expression was higher in skin melnaoma cells. It enhanced tyrosinase activity by increasing the membrane and melanosome localization of protein kinase CbetaII. UVB-induced up-regulation was required for UVB-induced melanin synthesis.
More...

AA Sequence

MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTT      1 - 70
SRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF     71 - 140
KRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA             141 - 201
//

Text Mined References (119)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25916113 [Role of syndecan-2 in amyloid plaque formation].
24956062 2015 Cell communication using intrinsically disordered proteins: what can syndecans say?
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24736615 2014 The HIV matrix protein p17 promotes the activation of human hepatic stellate cells through interactions with CXCR2 and Syndecan-2.
24662262 2014 The PDZ-binding domain of syndecan-2 inhibits LFA-1 high-affinity conformation.
24613844 2014 Interleukin-1? promotes extracellular shedding of syndecan-2 via induction of matrix metalloproteinase-7 expression.
24472179 2014 Syndecan-2 regulates melanin synthesis via protein kinase C ?II-mediated tyrosinase activation.
24447566 2014 Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.
24442880 2015 Leri's pleonosteosis, a congenital rheumatic disease, results from microduplication at 8q22.1 encompassing GDF6 and SDC2 and provides insight into systemic sclerosis pathogenesis.
More...