Property Summary

NCBI Gene PubMed Count 114
Grant Count 41
R01 Count 17
Funding $4,052,623.47
PubMed Score 128.25
PubTator Score 297.68

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (89)

PMID Text
26469385 HIV-1 MA interacts with SDC2 in primary hepatocytes
26018157 HIV-1 MA interacts with SDC2 in primary hepatocytes
25916113 In this review we considered the function of syndecan-2, the structure of syndecan-2 and its role in the formation of amyloid plaques.
24956062 Data indicate that the extracellular and cytoplasmic domains of syndecans 1/2/3/4 are intrinsically disordered regions.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24736615 HIV matrix protein p17 is pro-fibrogenic through its interactions both with CXCR2 and syndecan-2 on activated HSCs
24736615 HIV-1 MA interacts with SDC2 in primary hepatocytes
24736615 HIV-1 MA interacts with SDC2 in primary hepatocytes
24662262 The results demonstrate the importance of PDZ-binding domain of syndecan-2 for controlling LFA-1 affinity and cell adhesion.
24613844 Taken together, these data suggest that IL-1alpha regulates extracellular domain shedding of syndecan-2 through regulation of the MAP kinase-mediated MMP-7 expression in colon cancer cells.
More...

AA Sequence

MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTT      1 - 70
SRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF     71 - 140
KRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA             141 - 201
//

Text Mined References (119)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25916113 [Role of syndecan-2 in amyloid plaque formation].
24956062 2015 Cell communication using intrinsically disordered proteins: what can syndecans say?
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24736615 2014 The HIV matrix protein p17 promotes the activation of human hepatic stellate cells through interactions with CXCR2 and Syndecan-2.
24662262 2014 The PDZ-binding domain of syndecan-2 inhibits LFA-1 high-affinity conformation.
24613844 2014 Interleukin-1? promotes extracellular shedding of syndecan-2 via induction of matrix metalloproteinase-7 expression.
24472179 2014 Syndecan-2 regulates melanin synthesis via protein kinase C ?II-mediated tyrosinase activation.
24447566 2014 Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.
24442880 2015 Leri's pleonosteosis, a congenital rheumatic disease, results from microduplication at 8q22.1 encompassing GDF6 and SDC2 and provides insight into systemic sclerosis pathogenesis.
More...