Property Summary

NCBI Gene PubMed Count 52
PubMed Score 360.46
PubTator Score 166.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRES      1 - 70
AGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETR     71 - 140
CKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA    141 - 210
//

Text Mined References (52)

PMID Year Title