Property Summary

NCBI Gene PubMed Count 51
Grant Count 153
R01 Count 120
Funding $8,820,223.7
PubMed Score 351.00
PubTator Score 166.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P34130 Q6FH56 NT-4
Symbols NT4
NT5
NT-4
NT-5
NTF5
GLC10
GLC1O
NT-4/5

Gene

PDB

1B8M   1B98   1HCF  

Gene RIF (32)

PMID Text
25613138 The gene expression of neurotrophin 4 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25275256 No differences in plasma BDNF, NGF, NT3, NT4 and GDNF were found between autism spectrum disorders and control.
24607879 Elevated intra-amniotic levels of docosahexaenoic acid and arachidonic acid in the mid-trimester are correlated with increased NT4 concentrations.
23869086 Patients with mastocytosis featured elevated serum levels of NGF, NT-3, and NT-4. TrkA, TrkB, and TrkC expression was also elevated.
22815630 The NTF4 variants p.Gly157Ala and p.Ala182Val have been shown to be functional mutations, occurring in 2 of a total of 720 Chinese primary open-angle glaucoma patients.
22192858 Studies indicate neurotrophin family comprises nerve growth factor, brain-derived neurotrophic factor, neurotrophin-3 and neurotrophin-4 , and Zn(2+) and Cu(2+) interactions with them and modulate their activities through conformational changes.
22036954 NT-4/5 expression is associated with atrophy of the brain-parenchymal fraction measured by magnetic resonance imaging methods in patients with relapsing-remitting multiple sclerosis.
21350004 neurotrophin 4 contributes to breast cancer cell survival and can serve as prospective target to inhibit tumor growth
21330466 Suggest that a dysregulated TrkB/NT4/5 axis may contribute to several of the pathological lesions associated with pulmonary fibrosis, including type 2 alveolar cell hyperplasia and the proliferation of fibroblasts.
20806036 Identification of a single mutation in our study suggests that NTF4 mutations are a rare cause of primary open-angle glaucoma (0.6%, 95%CI 0.02%-3.16%) in Chinese people.
More...

AA Sequence

MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRES      1 - 70
AGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETR     71 - 140
CKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA    141 - 210
//

Text Mined References (51)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25275256 2014 Circulating levels of neurotrophic factors in autism spectrum disorders.
24607879 2014 Association between neurotrophin 4 and long-chain polyunsaturated fatty acid levels in mid-trimester amniotic fluid.
23869086 2013 Increased circulating levels of neurotrophins and elevated expression of their high-affinity receptors on skin and gut mast cells in mastocytosis.
22815630 2012 Evaluation of NTF4 as a causative gene for primary open-angle glaucoma.
22192858 2012 The inorganic perspectives of neurotrophins and Alzheimer's disease.
22036954 2011 Immune cell NT-3 expression is associated with brain atrophy in multiple sclerosis patients.
21350004 2011 Brain-derived neurotrophic factor and neurotrophin-4/5 are expressed in breast cancer and can be targeted to inhibit tumor cell survival.
21330466 2011 Neurotrophic tyrosine kinase receptor B/neurotrophin 4 signaling axis is perturbed in clinical and experimental pulmonary fibrosis.
20806036 2010 Identification of a novel mutation in the NTF4 gene that causes primary open-angle glaucoma in a Chinese population.
More...