Property Summary

NCBI Gene PubMed Count 51
PubMed Score 351.00
PubTator Score 166.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

Synonym

Accession P34130 Q6FH56 NT-4
Symbols NT4
NT5
NT-4
NT-5
NTF5
GLC10
GLC1O
NT-4/5

Gene

PDB

1B8M   1B98   1HCF  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (32)

PMID Text
25613138 The gene expression of neurotrophin 4 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25275256 No differences in plasma BDNF, NGF, NT3, NT4 and GDNF were found between autism spectrum disorders and control.
24607879 Elevated intra-amniotic levels of docosahexaenoic acid and arachidonic acid in the mid-trimester are correlated with increased NT4 concentrations.
23869086 Patients with mastocytosis featured elevated serum levels of NGF, NT-3, and NT-4. TrkA, TrkB, and TrkC expression was also elevated.
22815630 The NTF4 variants p.Gly157Ala and p.Ala182Val have been shown to be functional mutations, occurring in 2 of a total of 720 Chinese primary open-angle glaucoma patients.
22192858 Studies indicate neurotrophin family comprises nerve growth factor, brain-derived neurotrophic factor, neurotrophin-3 and neurotrophin-4 , and Zn(2+) and Cu(2+) interactions with them and modulate their activities through conformational changes.
22036954 NT-4/5 expression is associated with atrophy of the brain-parenchymal fraction measured by magnetic resonance imaging methods in patients with relapsing-remitting multiple sclerosis.
21350004 neurotrophin 4 contributes to breast cancer cell survival and can serve as prospective target to inhibit tumor growth
21330466 Suggest that a dysregulated TrkB/NT4/5 axis may contribute to several of the pathological lesions associated with pulmonary fibrosis, including type 2 alveolar cell hyperplasia and the proliferation of fibroblasts.
20806036 Identification of a single mutation in our study suggests that NTF4 mutations are a rare cause of primary open-angle glaucoma (0.6%, 95%CI 0.02%-3.16%) in Chinese people.
More...

AA Sequence

MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRES      1 - 70
AGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETR     71 - 140
CKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA    141 - 210
//

Text Mined References (51)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25275256 2014 Circulating levels of neurotrophic factors in autism spectrum disorders.
24607879 2014 Association between neurotrophin 4 and long-chain polyunsaturated fatty acid levels in mid-trimester amniotic fluid.
23869086 2013 Increased circulating levels of neurotrophins and elevated expression of their high-affinity receptors on skin and gut mast cells in mastocytosis.
22815630 2012 Evaluation of NTF4 as a causative gene for primary open-angle glaucoma.
22192858 2012 The inorganic perspectives of neurotrophins and Alzheimer's disease.
22036954 2011 Immune cell NT-3 expression is associated with brain atrophy in multiple sclerosis patients.
21350004 2011 Brain-derived neurotrophic factor and neurotrophin-4/5 are expressed in breast cancer and can be targeted to inhibit tumor cell survival.
21330466 2011 Neurotrophic tyrosine kinase receptor B/neurotrophin 4 signaling axis is perturbed in clinical and experimental pulmonary fibrosis.
20806036 2010 Identification of a novel mutation in the NTF4 gene that causes primary open-angle glaucoma in a Chinese population.
More...