Property Summary

NCBI Gene PubMed Count 16
Grant Count 30
R01 Count 9
Funding $7,625,890.58
PubMed Score 5.89
PubTator Score 15.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (3)

PMID Text
24659782 Data show that the transcription of angiogenin (ANG) and ribonuclease 4 (RNASE4) promoter is influenced by RNA polymerase III (Pol III) elements and could be differentially regulated by an intragenic CCCTC binding factor (CTCF)-dependent chromatin loop.
23143660 RNASE4 not only stimulates the formation of neurofilaments from mouse embryonic cortical neurons, but also protects hypothermia-induced degeneration
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRF      1 - 70
NTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQ     71 - 140
VPVHFDG                                                                   141 - 147
//

Text Mined References (16)

PMID Year Title
24659782 2014 Transcription of angiogenin and ribonuclease 4 is regulated by RNA polymerase III elements and a CCCTC binding factor (CTCF)-dependent intragenic chromatin loop.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23143660 2013 Ribonuclease 4 protects neuron degeneration by promoting angiogenesis, neurogenesis, and neuronal survival under stress.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
More...