Property Summary

NCBI Gene PubMed Count 61
PubMed Score 272.72
PubTator Score 363.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Inflammation 120 0.0 0.0
Mucopolysaccharidosis IV 5 0.0 0.0
Disease Target Count P-value
ependymoma 4679 6.9e-11
tuberculosis 2010 1.3e-07
psoriasis 6694 2.3e-04
osteosarcoma 7950 6.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mucopolysaccharidosis 26 7.789 3.9
Disease Target Count
Mucopolysaccharidosis, Type 4A 1

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.700 6.9e-11
osteosarcoma -1.673 6.8e-04
psoriasis -1.100 2.3e-04
tuberculosis 1.400 1.3e-07

Protein-protein Interaction (4)

Gene RIF (29)

AA Sequence

MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFP      1 - 70
NFYSANPLCSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGK     71 - 140
WHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYL    141 - 210
QEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADN    211 - 280
TFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL    281 - 350
ALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCP    351 - 420
GQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCN    421 - 490
WAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH                                          491 - 522
//

Text Mined References (64)

PMID Year Title