Property Summary

NCBI Gene PubMed Count 124
Grant Count 33
R01 Count 23
Funding $3,080,131.18
PubMed Score 364.07
PubTator Score 127.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (62)

PMID Text
26504025 High MCM-7 expression correlated with Cutaneous T-cell Lymphomas.
26188516 KCTD5 is not involved in polyubiquitylation of MCM7 replication factor.Formation of trimeric complexes of KCTD5/cullin3 with MCM7, ZNF711 and FAM193B.
25661590 Purified MCM4/6/7 complex containing the G364R MCM4 exhibited similar levels of single-stranded DNA binding and ATPase activities to the complex containing wild-type MCM4
25425645 MCM7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor
25075101 expression of MCM7 is an independent risk factor for recurrence-free survival in patients with Dukes C colorectal cancer
25046975 Results show that in Glioma patients, MCM 2, MCM3 and MCM7 mRNA are up-regulated and correlated with poor outcome.
24805087 MCM7 and G9a may serve as effective prognostic factors and could also be used as biomarkers for predicting various clinical outcomes of oesophageal squamous cell carcinoma
24647462 MCM7 expression may be a useful prognosis indicator in patients with diffuse-type gastric adenocarcinoma and its knockdown by RNA interference quenches its oncogenic property in gastric cancer
24496236 We observed that lower levels of MCM7 correlate with reduced cell proliferation, lower autophagic capacity, and higher intracellular protein abundance phenotypes of aged and systemic sclerosis cells.
24416400 The A to G base change in SNP rs999885 of MCM7 may provide a protective effect on the prognosis of intermediate or advanced hepatocellular carcinoma in the Chinese.
More...

AA Sequence

MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENA      1 - 70
RRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG     71 - 140
PSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQE    141 - 210
CQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPI    211 - 280
LRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV    281 - 350
KKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR    351 - 420
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANP    421 - 490
AYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMR    491 - 560
RYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDV    561 - 630
NEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE    631 - 700
YEELNVWQVNASRTRITFV                                                       701 - 719
//

Text Mined References (135)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26504025 2015 Expression of MCM-3 and MCM-7 in Primary Cutaneous T-cell Lymphomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26188516 2015 Interactions of cullin3/KCTD5 complexes with both cytoplasmic and nuclear proteins: Evidence for a role in protein stabilization.
25661590 2015 G364R mutation of MCM4 detected in human skin cancer cells affects DNA helicase activity of MCM4/6/7 complex.
25425645 2015 The DNA replication licensing factor miniature chromosome maintenance 7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25075101 2014 Minichromosome maintenance protein 7 is a risk factor for recurrence in patients with Dukes C colorectal cancer.
25046975 2014 Minichromosome Maintenance (MCM) Family as potential diagnostic and prognostic tumor markers for human gliomas.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
More...