Property Summary

NCBI Gene PubMed Count 138
PubMed Score 387.18
PubTator Score 127.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.246 1.4e-02
adult high grade glioma 1.500 1.8e-03
astrocytoma 1.500 1.6e-17
atypical teratoid / rhabdoid tumor 2.200 9.9e-06
Endometriosis 1.173 4.5e-02
ependymoma 1.100 7.8e-05
glioblastoma 2.000 1.7e-09
group 3 medulloblastoma 3.400 7.6e-07
lung adenocarcinoma 1.164 2.6e-04
lung cancer 1.200 3.5e-04
malignant mesothelioma 1.900 1.1e-06
medulloblastoma, large-cell 3.100 1.7e-05
nasopharyngeal carcinoma 1.100 9.1e-04
non-small cell lung cancer 1.819 4.0e-21
oligodendroglioma 1.500 4.6e-02
ovarian cancer 1.200 2.0e-03
primitive neuroectodermal tumor 2.600 9.9e-06

Gene RIF (71)

AA Sequence

MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENA      1 - 70
RRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG     71 - 140
PSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQE    141 - 210
CQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPI    211 - 280
LRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV    281 - 350
KKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR    351 - 420
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANP    421 - 490
AYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMR    491 - 560
RYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDV    561 - 630
NEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE    631 - 700
YEELNVWQVNASRTRITFV                                                       701 - 719
//

Text Mined References (150)

PMID Year Title