Property Summary

NCBI Gene PubMed Count 68
PubMed Score 76.28
PubTator Score 40.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.036 2.0e-02
adult high grade glioma 1.100 1.2e-03
astrocytoma 1.400 2.1e-16
Astrocytoma, Pilocytic 1.400 5.2e-05
Atopic dermatitis 1.100 3.5e-05
atypical teratoid / rhabdoid tumor 1.300 3.2e-04
ependymoma 1.300 7.6e-06
gastric carcinoma 1.700 3.4e-02
glioblastoma 1.200 4.1e-06
group 3 medulloblastoma 1.800 1.3e-04
juvenile dermatomyositis 1.022 1.3e-10
malignant mesothelioma 1.200 1.1e-05
medulloblastoma, large-cell 1.700 2.7e-05
Multiple myeloma 1.144 4.5e-02
non-small cell lung cancer 1.451 3.6e-16
oligodendroglioma 1.400 8.1e-11
osteosarcoma -1.522 8.3e-04
ovarian cancer 2.200 5.3e-05
primitive neuroectodermal tumor 1.600 4.0e-05
psoriasis 1.200 8.0e-04
Waldenstrons macroglobulinemia 2.040 1.3e-03

 MGI Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (27)

AA Sequence

MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWI      1 - 70
EVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSL     71 - 140
KSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLD    141 - 210
PYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSR    211 - 280
GRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMK    281 - 350
KAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR    351 - 420
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANS    421 - 490
VFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVSALTQTQAVEGEIDLAKLK    491 - 560
KFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQP    561 - 630
FATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTK    631 - 700
QKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK                                        701 - 734
//

Text Mined References (75)

PMID Year Title