Property Summary

NCBI Gene PubMed Count 63
PubMed Score 72.72
PubTator Score 40.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 2.07694011202742E-16
non-small cell lung cancer 2798 3.58070793931489E-16
oligodendroglioma 2849 8.11589761181226E-11
juvenile dermatomyositis 1189 1.27494903635095E-10
glioblastoma 5572 1.14259146458573E-9
posterior fossa group A ependymoma 1511 8.07348309853477E-8
pediatric high grade glioma 2712 2.16677745611671E-6
malignant mesothelioma 3163 3.53594010597973E-6
pilocytic astrocytoma 3086 2.51977240144575E-5
Atopic dermatitis 944 3.51908545677595E-5
ovarian cancer 8492 5.28422195629757E-5
group 3 medulloblastoma 2254 5.89425295049927E-5
psoriasis 6685 1.1242303880182E-4
primitive neuroectodermal tumor 3031 2.85880025999533E-4
atypical teratoid / rhabdoid tumor 4369 3.23258706726222E-4
medulloblastoma, large-cell 6234 5.64442569094919E-4
osteosarcoma 7933 8.26378260547199E-4
Waldenstrons macroglobulinemia 765 0.00133139665441034
adrenocortical carcinoma 1427 0.00762422561122936
gastric carcinoma 832 0.0344560933564037
Multiple myeloma 1328 0.0446323741807501
Disease Target Count Z-score Confidence
Melanoacanthoma 2 4.135 2.1
Cancer 2346 3.377 1.7

Expression

  Differential Expression (21)

Synonym

Accession P33992 O60785 Q14578 Q9BTJ4 Q9BWL8
Symbols CDC46
P1-CDC46

Gene

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (22)

PMID Text
25596707 we could consider miRNA-10b and MCM5 mRNA as prognostic markers and potential therapeutic targets in breast cancer to be applied to other patient data sets.
24245508 The increased expression of MCM5 protein begins at the oral pre-cancerous stage and is significantly associated with the aggressive progression and poor prognosis of OSCC.
24190967 Data indicate that MCM-BP binds USP7 on chromatin and can mediate an interaction between the USP7 and MCM proteins.
23095216 The results of this study demonistrated that Mcm5 shows a highly significant correlation with Alcohol use disorders-induced decreases in the volume of the left parietal supramarginal gyrus and neuropsychological measures.
22944692 Positional proteomics analysis identifies the cleavage of human minichromosome maintenance complex component 5 (MCM5) at amino acid residues 10-11 and 13-14 by the HIV-1 protease
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
21478101 lack of MCM5 proteins expression which may explain commonly known low mitotic activity of desmoid tumour cells
21233845 MicroRNA miR-885-5p targets CDK2 and MCM5, activates p53 and inhibits proliferation and survival.
21106093 Could use the urinary hTERT, SENP1, PPP1CA, and MCM5 mRNA to detect bladder cancer recurrence.
20694513 MCM-5 expression was significantly associated with tumor size, presence of lymph node metastases and tumor histopathological stage. Patients with high MCM-5 expression had significantly shorter survival times.
More...

AA Sequence

MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWI      1 - 70
EVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSL     71 - 140
KSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLD    141 - 210
PYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSR    211 - 280
GRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMK    281 - 350
KAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR    351 - 420
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANS    421 - 490
VFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVSALTQTQAVEGEIDLAKLK    491 - 560
KFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQP    561 - 630
FATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTK    631 - 700
QKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK                                        701 - 734
//

Text Mined References (70)

PMID Year Title
25596707 2015 MicroRNA-10b and minichromosome maintenance complex component 5 gene as prognostic biomarkers in breast cancer.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24245508 2014 Increased expression of MCM5 is significantly associated with aggressive progression and poor prognosis of oral squamous cell carcinoma.
24190967 2014 A role for USP7 in DNA replication.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095216 2012 Evaluation of cell proliferation, apoptosis, and DNA-repair genes as potential biomarkers for ethanol-induced CNS alterations.
22918583 2012 The eukaryotic Mcm2-7 replicative helicase.
More...