Property Summary

NCBI Gene PubMed Count 63
Grant Count 25
R01 Count 16
Funding $1,648,006.11
PubMed Score 72.72
PubTator Score 40.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 MGI Term (1)

Gene RIF (22)

PMID Text
25596707 we could consider miRNA-10b and MCM5 mRNA as prognostic markers and potential therapeutic targets in breast cancer to be applied to other patient data sets.
24245508 The increased expression of MCM5 protein begins at the oral pre-cancerous stage and is significantly associated with the aggressive progression and poor prognosis of OSCC.
24190967 Data indicate that MCM-BP binds USP7 on chromatin and can mediate an interaction between the USP7 and MCM proteins.
23095216 The results of this study demonistrated that Mcm5 shows a highly significant correlation with Alcohol use disorders-induced decreases in the volume of the left parietal supramarginal gyrus and neuropsychological measures.
22944692 Positional proteomics analysis identifies the cleavage of human minichromosome maintenance complex component 5 (MCM5) at amino acid residues 10-11 and 13-14 by the HIV-1 protease
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
21478101 lack of MCM5 proteins expression which may explain commonly known low mitotic activity of desmoid tumour cells
21233845 MicroRNA miR-885-5p targets CDK2 and MCM5, activates p53 and inhibits proliferation and survival.
21106093 Could use the urinary hTERT, SENP1, PPP1CA, and MCM5 mRNA to detect bladder cancer recurrence.
20694513 MCM-5 expression was significantly associated with tumor size, presence of lymph node metastases and tumor histopathological stage. Patients with high MCM-5 expression had significantly shorter survival times.
More...

AA Sequence

MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWI      1 - 70
EVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSL     71 - 140
KSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLD    141 - 210
PYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSR    211 - 280
GRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMK    281 - 350
KAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR    351 - 420
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANS    421 - 490
VFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVSALTQTQAVEGEIDLAKLK    491 - 560
KFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQP    561 - 630
FATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTK    631 - 700
QKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK                                        701 - 734
//

Text Mined References (70)

PMID Year Title
25596707 2015 MicroRNA-10b and minichromosome maintenance complex component 5 gene as prognostic biomarkers in breast cancer.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24245508 2014 Increased expression of MCM5 is significantly associated with aggressive progression and poor prognosis of oral squamous cell carcinoma.
24190967 2014 A role for USP7 in DNA replication.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095216 2012 Evaluation of cell proliferation, apoptosis, and DNA-repair genes as potential biomarkers for ethanol-induced CNS alterations.
22918583 2012 The eukaryotic Mcm2-7 replicative helicase.
More...