Property Summary

NCBI Gene PubMed Count 78
PubMed Score 86.82
PubTator Score 50.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
IMMUNODEFICIENCY 54 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Bowen-Conradi syndrome 16 3.734 1.9
IMAGe syndrome 8 3.365 1.7
Cancer 2499 3.328 1.7

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.312 5.4e-04
atypical teratoid / rhabdoid tumor 1.600 6.4e-05
Breast cancer 2.700 4.2e-02
breast carcinoma 1.100 8.8e-21
colon cancer 1.400 4.1e-03
ductal carcinoma in situ 1.300 3.8e-03
Endometriosis 1.278 1.5e-02
glioblastoma 1.500 1.8e-07
group 3 medulloblastoma 1.900 4.4e-05
intraductal papillary-mucinous carcinoma... 1.400 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.700 9.2e-04
invasive ductal carcinoma 1.300 1.1e-03
lung adenocarcinoma 1.700 1.2e-08
lung cancer 1.800 1.6e-03
malignant mesothelioma 2.000 1.5e-07
medulloblastoma, large-cell 1.600 6.4e-05
nasopharyngeal carcinoma 1.300 3.3e-05
non-small cell lung cancer 2.484 7.0e-26
osteosarcoma 1.801 3.2e-02
ovarian cancer 1.300 4.6e-08
pediatric high grade glioma 1.200 6.4e-03
primitive neuroectodermal tumor 1.500 3.9e-04
psoriasis -1.700 4.0e-04

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFS      1 - 70
SPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIV     71 - 140
ASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNV    141 - 210
NCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDID    211 - 280
QLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQ    281 - 350
MIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH    351 - 420
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRK    421 - 490
DFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQT    491 - 560
GALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTT    561 - 630
IENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP    631 - 700
RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALK    701 - 770
QSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF    771 - 840
EEALRALADDDFLTVTGKTVRLL                                                   841 - 863
//

Text Mined References (89)

PMID Year Title