Property Summary

NCBI Gene PubMed Count 74
PubMed Score 84.13
PubTator Score 50.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 5.49427857050493E-28
non-small cell lung cancer 2798 6.97477305049626E-26
lung adenocarcinoma 2714 1.16381698476736E-8
malignant mesothelioma 3163 1.5229301047051E-7
pediatric high grade glioma 2712 1.31063512232732E-5
lung cancer 4473 1.46604956284009E-5
nasopharyngeal carcinoma 1056 3.32526320214087E-5
atypical teratoid / rhabdoid tumor 4369 6.35627059544625E-5
medulloblastoma, large-cell 6234 6.42739350668585E-5
ovarian cancer 8492 1.21611951240989E-4
group 3 medulloblastoma 2254 1.51994419876126E-4
primitive neuroectodermal tumor 3031 3.88239888471385E-4
psoriasis 6685 4.0407431069413E-4
adrenocortical carcinoma 1427 5.3833000668315E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.12375199759117E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.2201360736623E-4
glioblastoma 5572 0.00278855052353775
ductal carcinoma in situ 1745 0.00381244628415211
colon cancer 1475 0.00409133716271444
invasive ductal carcinoma 2950 0.00410238555075544
Endometriosis 535 0.0152206763707753
osteosarcoma 7933 0.0317322401498981
Breast cancer 3099 0.0421963240747774
Disease Target Count Z-score Confidence
Bowen-Conradi syndrome 16 3.8 1.9
IMAGe syndrome 6 3.536 1.8
Cancer 2346 3.21 1.6

Expression

Synonym

Accession P33991 Q8NEH1 Q99658
Symbols NKCD
CDC21
CDC54
NKGCD
hCdc21
P1-CDC21

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (27)

PMID Text
26188903 We did not find any evidence of augmented response to a short-term (48 h) cisplatin treatment in these MCM4-deficient cells. However, MCM4-/HPV16+ SiHa cells cannot withstand a prolonged treatment (up to 5 days) of even a sublethal dosage of cisplatin
25733866 Mutant p53 depletion profoundly influenced PARP1 localization and increased the level of PCNA and MCM4 proteins.
25661590 Purified MCM4/6/7 complex containing the G364R MCM4 exhibited similar levels of single-stranded DNA binding and ATPase activities to the complex containing wild-type MCM4
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
23264620 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
22668557 point mutation of MCM4 perturbs proper interaction with MCM6 to affect complex formation of MCM4/6/7 that is a core structure of MCM2-7 complex
22499342 Mutations in MCM4/PRKDC represent a novel cause of DNA breakage and NK cell deficiency.
22354170 MCM4 mutation may have a role in adrenal failure, short stature, and natural killer cell deficiency
22354167 partial MCM4 deficiency results in a genetic syndrome of growth retardation with adrenal insufficiency and selective NK deficiency
More...

AA Sequence

MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFS      1 - 70
SPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIV     71 - 140
ASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNV    141 - 210
NCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDID    211 - 280
QLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQ    281 - 350
MIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH    351 - 420
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRK    421 - 490
DFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQT    491 - 560
GALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTT    561 - 630
IENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP    631 - 700
RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALK    701 - 770
QSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF    771 - 840
EEALRALADDDFLTVTGKTVRLL                                                   841 - 863
//

Text Mined References (85)

PMID Year Title
26188903 2015 HPV-type-specific response of cervical cancer cells to cisplatin after silencing replication licensing factor MCM4.
25733866 2015 Proteome-wide analysis of mutant p53 targets in breast cancer identifies new levels of gain-of-function that influence PARP, PCNA, and MCM4.
25661590 2015 G364R mutation of MCM4 detected in human skin cancer cells affects DNA helicase activity of MCM4/6/7 complex.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24386425 2013 Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23264620 2013 Peroxisome proliferator-activated receptor ? coactivator 1? (PGC-1?) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...