Property Summary

NCBI Gene PubMed Count 104
Grant Count 61
R01 Count 37
Funding $7,665,713.58
PubMed Score 198.20
PubTator Score 132.46

Knowledge Summary

Patent (42,180)

Expression

Synonym

Accession P33981 A8K8U5 B2RDW2 E1P543 Q15272 Q5TCS0 Q9BW51 Q9NTM0
Symbols ESK
PYT
CT96
MPH1
MPS1
MPS1L1

Gene

TTK

PDB

2X9E   2ZMC   2ZMD   3CEK   3DBQ   3GFW   3H9F   3HMN   3HMO   3HMP   3VQU   3W1F   3WYX   3WYY   3WZJ   3WZK   4B94   4BHZ   4BI0   4BI1   4BI2   4C4E   4C4F   4C4G   4C4H   4C4I   4C4J   4CV8   4CV9   4CVA   4D2S   4H7X   4H7Y   4JS8   4JT3   4O6L   4ZEG   5AP0   5AP1   5AP2   5AP3   5AP4   5AP5   5AP6   5AP7   5EH0   5EHY   5EI2   5EI6   5EI8  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (85)

PMID Text
26953350 Interaction of the central domain of ARHGEF17 with Mps1.
26637805 Results suggest that monopolar spindle 1 kinase (MPS1) inhibition could be used as a therapeutic strategy for targeting tetraploid cancer cells.
26586430 Knockdown of Cdkn3 stabilizes Mps1 at centrosomes.
26531827 Data show that TTK protein kinase (hMps1) interacts with proto-oncogene protein MDM2 in vivo and in vitro.
26418879 TTK contributes to hepatocellular carcinoma tumorigenesis via promoting cell proliferation and migration
26398286 Depletion of Mps1 reduces tumor cell viability relative to normal cells.
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
26240331 Mps1 functions in chromosome alignment by orchestrating Ndc80C-MT interactions
26202014 Daata show five point mutations in the kinase domain of mitotic checkpoint kinase MPS1 that confer resistance against multiple inhibitors.
26068855 the amino-terminal localization module of the spindle assembly checkpoint protein kinase MPS1 directly interacts with the HEC1 (highly expressed in cancer 1) calponin homology domain in the NDC80 (nuclear division cycle 80) kinetochore complex in vitro, in a phosphorylationdependent manner.
More...

AA Sequence

MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMANNPEDWLSLLL      1 - 70
KLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELKAIQEPDDARDYFQMARANCK     71 - 140
KFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEMLEIALRNLNLQKKQLLSEEEKKNLSASTVLT    141 - 210
AQESFSGSLGHLQNRNNSCDSRGQTTKARFLYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLN    211 - 280
SPDCDVKTDDSVVPCFMKRQTSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELII    281 - 350
TDSITLKNKTESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ    351 - 420
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQLSTPYGQPAC    421 - 490
FQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA    491 - 560
DNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKN    561 - 630
MLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSS    631 - 700
SRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKC    701 - 770
CLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE    771 - 840
SHNSSSSKTFEKKRGKK                                                         841 - 857
//

Text Mined References (116)

PMID Year Title
26953350 2016 ARHGEF17 is an essential spindle assembly checkpoint factor that targets Mps1 to kinetochores.
26637805 2016 Whole-genome duplication increases tumor cell sensitivity to MPS1 inhibition.
26586430 2015 The Tumor Suppressor Cdkn3 Is Required for Maintaining the Proper Number of Centrosomes by Regulating the Centrosomal Stability of Mps1.
26531827 2016 Requirement for human Mps1/TTK in oxidative DNA damage repair and cell survival through MDM2 phosphorylation.
26418879 2015 TTK activates Akt and promotes proliferation and migration of hepatocellular carcinoma cells.
26398286 2015 Mitotic Checkpoint Kinase Mps1 Has a Role in Normal Physiology which Impacts Clinical Utility.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
26240331 2015 Dynamic localization of Mps1 kinase to kinetochores is essential for accurate spindle microtubule attachment.
26202014 2015 Naturally Occurring Mutations in the MPS1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
26068855 2015 CELL DIVISION CYCLE. Competition between MPS1 and microtubules at kinetochores regulates spindle checkpoint signaling.
More...