Property Summary

NCBI Gene PubMed Count 104
PubMed Score 198.20
PubTator Score 132.46

Knowledge Summary

Patent (42,180)

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 1.800 4.1e-07
esophageal adenocarcinoma 1.500 1.8e-02
psoriasis 1.800 1.1e-85
glioblastoma 3.500 2.0e-11
posterior fossa group A ependymoma 2.300 2.2e-07
sonic hedgehog group medulloblastoma 4.700 2.5e-13
atypical teratoid / rhabdoid tumor 3.600 2.8e-11
medulloblastoma, large-cell 4.100 2.2e-07
primitive neuroectodermal tumor 4.100 3.7e-07
Atopic dermatitis 2.000 5.3e-05
adrenocortical carcinoma 2.799 8.1e-05
non-small cell lung cancer 3.455 2.6e-30
intraductal papillary-mucinous carcinoma... 3.000 2.0e-04
intraductal papillary-mucinous neoplasm ... 3.500 6.1e-04
lung cancer 1.400 2.4e-03
colon cancer 1.600 2.2e-03
pancreatic cancer 1.400 1.1e-04
lung adenocarcinoma 1.200 2.1e-06
pediatric high grade glioma 3.400 1.3e-08
non primary Sjogren syndrome sicca -1.100 2.3e-02
nasopharyngeal carcinoma 1.300 9.1e-04
Endometriosis 1.524 2.6e-02
Breast cancer 2.400 2.3e-11
breast carcinoma 1.700 5.1e-34
ductal carcinoma in situ 2.200 1.4e-02
invasive ductal carcinoma 2.400 1.2e-03
ovarian cancer 2.800 6.3e-07

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (85)

PMID Text
26953350 Interaction of the central domain of ARHGEF17 with Mps1.
26637805 Results suggest that monopolar spindle 1 kinase (MPS1) inhibition could be used as a therapeutic strategy for targeting tetraploid cancer cells.
26586430 Knockdown of Cdkn3 stabilizes Mps1 at centrosomes.
26531827 Data show that TTK protein kinase (hMps1) interacts with proto-oncogene protein MDM2 in vivo and in vitro.
26418879 TTK contributes to hepatocellular carcinoma tumorigenesis via promoting cell proliferation and migration
26398286 Depletion of Mps1 reduces tumor cell viability relative to normal cells.
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
26240331 Mps1 functions in chromosome alignment by orchestrating Ndc80C-MT interactions
26202014 Daata show five point mutations in the kinase domain of mitotic checkpoint kinase MPS1 that confer resistance against multiple inhibitors.
26068855 the amino-terminal localization module of the spindle assembly checkpoint protein kinase MPS1 directly interacts with the HEC1 (highly expressed in cancer 1) calponin homology domain in the NDC80 (nuclear division cycle 80) kinetochore complex in vitro, in a phosphorylationdependent manner.
26068854 the checkpoint protein kinase monopolar spindle 1 (Mps1) directly bound to Ndc80C through two independent interactions.
25886724 N-terminal of Mps1 was identified a high sequence similarity to the classic NES,a fusion of this motif with EGFP results in dramatic exclusion of the fusion protein from the nucleus.
25731686 High Mps1 expression, both at mRNA and protein levels, was found to be associated with high tumor grade, high Ki67 expression, and worse survival ,particularly in Triple Negative Breast Cancer .
25265012 results highlight the importance of dynamic autophosphorylation of Mps1 in regulating accurate chromosome segregation and ensuring proper mitotic progression
25246613 PP2A-B56 is a key phosphatase for the removal of the Mps1-mediated Knl1 phosphorylations necessary for Bub1/BubR1 recruitment in mammalian cells.
25137017 High TTK protein expression is associated with pancreatic cancer.
25063032 findings suggest that high levels of Mps1 contribute to tumorigenesis by attenuating the spindle assembly checkpoint
24934155 Mps1 governs chromosomal organization during the early stage of mitosis to facilitate proper chromosome segregation.
24905462 TTK was up-regulated in HCC specimens. TTK overexpression promoted cell proliferation, anchor-dependent colony formation and resistance to sorafenib of HCC cells.
24859455 The dual-specificity protein kinase TTK, which is a key mitotic checkpoint regulator with links to p53 signaling, was further shown to be a promising overall prognostic marker for Hepatocellular carcinoma in the large patient cohort.
24764296 Our results provide evidence of a newly identified hMps1 phosphorylation site that is involved in the mitotic checkpoint and that CHK2 contributes to chromosomal stability through hMps1.
24462521 MPS1 was the most significant gene associated with TP53 status and poor prognosis in breast cancer patients.
24282275 Data suggest that MPS1 kinase inhibition as a pancreatic ductal adenocarcinoma (PDAC) treatment strategy.
24187132 a novel role for Aurora B-Hec1-Mps1 signaling axis in governing accurate chromosome segregation in mitosis
24151075 sustained MPS1 activity is required for maintaining both the MAD1.C-MAD2 complex and open MAD2 (O-MAD2) at unattached kinetochores to facilitate C-MAD2 production
24108125 two proteins that interact with BLM, RMI1 and RMI2, are phosphorylated upon SAC activation, and, like BLM, RMI1, and RMI2, are phosphorylated in an MPS1-dependent manner.
23933817 MPS1 inhibitors may exert robust anticancer activity, either as standalone therapeutic interventions or combined with microtubule-targeting chemicals.
23726842 Oncogenic B-Raf(V600E) abrogates the AKT/B-Raf/Mps1 interaction in melanoma cells.
23700430 MPS1 is protein kinase overexpressed in triple-negative breast cancer.
23569217 These data are consistent with a model in which Aurora B activity relieves a tetratricopeptide repeat domain-dependent inhibitory constraint on MPS1 localization.
23531678 Ultraviolet-C irradiation delays mitotic progression by recruiting Mps1 to kinetochores.
23510141 Mps1 is an acidophilic kinase with a striking tendency for phosphorylation of threonines.
23388454 a VDAC3-Mps1 module at the centrosome promotes ciliary disassembly during cell cycle entry.
23321637 Data propose that Chk1 and Mps1 jointly regulate Aurora-B, MCAK, Kif2b and Hec1 to correct merotelic attachments. These results suggest a role for Chk1 and Mps1 in error correction.
23067341 A stretch of amino acids at the very N-terminus of Mps1 is required for dimer formation.
22935710 VDAC3 is present at the mother centriole and modulates centriole assembly by recruiting Mps1 to centrosomes.
22732840 Mps1 stimulates Aurora B recruitment to centromere.
22430208 We propose that , and that persistent phosphorylation of Mps1 through BRAF(V600E) signaling is a key event in disrupting the control of centrosome duplication and chromosome stability that may contribute to tumorigenesis.
21778823 our studies reveal a novel cell cycle-dependent nuclear translocation signal in the N terminus of Mps1 and suggest that timely nuclear entry could be important for sustaining spindle assembly checkpoint responses.
21587233 Aurora B potentiates Mps1 activation to ensure rapid checkpoint at the onset of mitosis.
21533207 Analysis on hMps1 autophosphorylation sites demonstrates that hMps1 has a substrate preference similar to Plk1 kinase
21475725 conditional inactivation of Mps1 inactivates the mitotic checkpoint, increases chromosome alignment defects, and compromises cell viability in vitro
21402910 Data suggest that high levels of Mps1 in breast cancer cells likely contribute to these cells tolerating aneuploidy.
21163887 High frequency of TTK mutations is associated with microsatellite-unstable colorectal cancer.
20980622 Mps1-dependent phosphorylation of Cetn2 stimulates the canonical centriole assembly pathway.
20937696 Release of Mps1 from kinetochores is essential for mitotic checkpoint silencing and a fast metaphase-to-anaphase transition.
20884615 Mps1 mutant without the unstructured tail region is defective in mediating spindle assembly checkpoint activation.
20861309 Data show that OAZ promotes the removal of Mps1 from centrosomes, and centrosome overproduction caused by reducing OAZ activity requires Mps1.
20729194 the sequential actions of the APC-c(Cdc20) and APC-c(Cdh1) ubiquitin ligases regulate the clearance of Mps1 levels and are critical for Mps1 functions during the cell cycle in human cells.
20624902 Mps1 directs the assembly of Cdc20 inhibitory complexes during interphase and mitosis to control M phase timing and spindle checkpoint signaling.
20624901 Dissecting the role of MPS1 in chromosome biorientation and the spindle checkpoint through the small molecule inhibitor reversine.
20624899 Sustained Mps1 activity is required in mitosis to recruit O-Mad2 to the Mad1-C-Mad2 core complex.
20624898 Mps1 kinase activity ensures accurate chromosome segregation through its recruitment to kinetochores of mitotic checkpoint proteins
20508983 Observational study of gene-disease association. (HuGE Navigator)
20422024 Mps1 has multiple controls over mitotic checkpoint activity; short-term inhibition of Mps1 catalytic activity is sufficient to kill cells
20100468 Microtubule inhibitor-induced phosphorylation of BNIP3, Bcl-2 and Bcl-xL occurs independently of the AKT/mTor and JNK kinase pathways and requires Mps1 mitotic checkpoint kinase activity
20057968 Observational study of gene-disease association. (HuGE Navigator)
19332559 Stabilization and activation of p53 by spindle disruption requires the spindle checkpoint kinase TTK/hMps1.
19151762 a regulatory loop between TTK/hMps1 and CHK2 whereby DNA damage-activated CHK2 may facilitate the stabilization of TTK/hMps1, therefore maintaining the checkpoint control.
19120698 identified Mps1 autophosphorylation sites in the activation and the P+1 loops. Whereas activation loop autophosphorylation enhances kinase activity, autophosphorylation at the P+1 loop (T686) is associated with the active kinase
19015317 Mps1 is a major but not the exclusive kinase that specifies BubR1 phosphorylation in vivo.
18923149 Results demonstrate that phosphorylation of Mps1 at T12 and S15 is required for Mps1 recruitment to the kinetochore.
18794806 TTK controls nuclear targeting of c-Abl by 14-3-3-coupled phosphorylation in response to oxidative stress.
18680479 Results reveal the complexity of Mps1 regulation by multi-site phosphorylation, and demonstrate conclusively that phosphorylated Mps1 associates with centrosomes in mitotic human cells.
18541701 In human cells, Mps1 catalytic activity is required for spindle checkpoint function and recruitment of Mad2.
18480048 crystallographic analysis of the catalytic domain of the mitotic checkpoint kinase Mps1 in complex with SP600125
18243099 MPS1 phosphorylates borealin to control aurora kinase activity and chromosome alignment.
18083840 the endogenous Mps1 in mitotic HeLa cells is phosphorylated on T676, a residue in the activation loop.
18071315 B-Raf(V600E) signaling deregulates the mitotic spindle checkpoint through stabilizing Mps1 levels in melanoma cells.
17998396 PRP4 is a spindle assembly checkpoint protein required for MPS1 localization to the kinetochores.
17804818 Mps1 mediates cyclin A-dependent centrosome reduplication
17784873 Data show that TTK protein kinase, lymphocyte antigen 6 complex locus K and insulin-like growth factor (IGF)-II mRNA binding protein 3 are tumor-associated antigens recognized by cytotoxic T lymphocytes and HLA-A24-restricted epitope peptides.
17728254 site-specific Mps1 autophosphorylation within the activation loop is required for full activity in vitro and function in vivo.
17573779 Mortalin binds to Mps1, and is phosphorylated by Mps1 on Thr62 and Ser65
17452325 analysis of a novel functional link between Mps1 and Smads in a non-canonical Smad signaling pathway
17268814 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17210994 Observational study of gene-disease association. (HuGE Navigator)
16864798 Results suggest that MPS1-dependent BLM phosphorylation is important for ensuring accurate chromosome segregation, and its deregulation may contribute to cancer.
16446370 MPS1 is negatively regulated by the p53 protein after DNA damage by SN-38. The lack of suppression of MPS1 in p53-deficient cells leads to damage-induced apoptosis.
16080195 findings indicate that Aurora-A and hMPS1 aberrations are uncommon in aggressive lymphomas but Aurora-A overexpression may contribute to numerical chromosomal alterations in occasional mantle cell lymphomas
15618221 TTK functions upstream from CHK2 in response to DNA damage
15304323 The inter-relationship between TTK and TACC2 established provides new avenue to study centrosome and spindle dynamics underlying cell divisional control.
14657364 is required for centrosome duplication and for the normal progression of mitosis
12686615 is required by cells to arrest in mitosis in response to spindle defects and kinetochore defects resulting from the loss of the kinesin-like protein
11927556 human Mps1(TTK kinase) is essential for the establishment and/or maintenance of the spindle assembly checkpoint, but dispensable for centrosome duplication.

AA Sequence

MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMANNPEDWLSLLL      1 - 70
KLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELKAIQEPDDARDYFQMARANCK     71 - 140
KFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEMLEIALRNLNLQKKQLLSEEEKKNLSASTVLT    141 - 210
AQESFSGSLGHLQNRNNSCDSRGQTTKARFLYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLN    211 - 280
SPDCDVKTDDSVVPCFMKRQTSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELII    281 - 350
TDSITLKNKTESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ    351 - 420
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQLSTPYGQPAC    421 - 490
FQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA    491 - 560
DNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKN    561 - 630
MLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSS    631 - 700
SRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKC    701 - 770
CLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE    771 - 840
SHNSSSSKTFEKKRGKK                                                         841 - 857
//

Text Mined References (116)

PMID Year Title
26953350 2016 ARHGEF17 is an essential spindle assembly checkpoint factor that targets Mps1 to kinetochores.
26637805 2016 Whole-genome duplication increases tumor cell sensitivity to MPS1 inhibition.
26586430 2015 The Tumor Suppressor Cdkn3 Is Required for Maintaining the Proper Number of Centrosomes by Regulating the Centrosomal Stability of Mps1.
26531827 2016 Requirement for human Mps1/TTK in oxidative DNA damage repair and cell survival through MDM2 phosphorylation.
26418879 2015 TTK activates Akt and promotes proliferation and migration of hepatocellular carcinoma cells.
26398286 2015 Mitotic Checkpoint Kinase Mps1 Has a Role in Normal Physiology which Impacts Clinical Utility.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
26240331 2015 Dynamic localization of Mps1 kinase to kinetochores is essential for accurate spindle microtubule attachment.
26202014 2015 Naturally Occurring Mutations in the MPS1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
26068855 2015 CELL DIVISION CYCLE. Competition between MPS1 and microtubules at kinetochores regulates spindle checkpoint signaling.
26068854 2015 CELL DIVISION CYCLE. Kinetochore attachment sensed by competitive Mps1 and microtubule binding to Ndc80C.
25886724 2015 A putative N-terminal nuclear export sequence is sufficient for Mps1 nuclear exclusion during interphase.
25731686 2015 Targeting the spindle assembly checkpoint for breast cancer treatment.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25265012 2014 Dynamic autophosphorylation of mps1 kinase is required for faithful mitotic progression.
25246613 2014 PP2A-B56 opposes Mps1 phosphorylation of Knl1 and thereby promotes spindle assembly checkpoint silencing.
25137017 2014 Key role of dual specificity kinase TTK in proliferation and survival of pancreatic cancer cells.
25063032 2014 Overexpression of Mps1 in colon cancer cells attenuates the spindle assembly checkpoint and increases aneuploidy.
24934155 2014 Mps1 phosphorylation of condensin II controls chromosome condensation at the onset of mitosis.
24905462 2014 Expression and function analysis of mitotic checkpoint genes identifies TTK as a potential therapeutic target for human hepatocellular carcinoma.
24859455 2014 Identification of prognostic biomarkers in hepatitis B virus-related hepatocellular carcinoma and stratification by integrative multi-omics analysis.
24764296 2014 Phosphorylation at threonine 288 by cell cycle checkpoint kinase 2 (CHK2) controls human monopolar spindle 1 (Mps1) kinetochore localization.
24462521 2014 TP53 mutation-correlated genes predict the risk of tumor relapse and identify MPS1 as a potential therapeutic kinase in TP53-mutated breast cancers.
24282275 2014 Selective inhibition of pancreatic ductal adenocarcinoma cell growth by the mitotic MPS1 kinase inhibitor NMS-P715.
24187132 2013 Phosphorylation of microtubule-binding protein Hec1 by mitotic kinase Aurora B specifies spindle checkpoint kinase Mps1 signaling at the kinetochore.
24151075 2013 Monopolar spindle 1 (MPS1) kinase promotes production of closed MAD2 (C-MAD2) conformer and assembly of the mitotic checkpoint complex.
24108125 2013 Monopolar spindle 1 (MPS1) protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III ?-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis.
23933817 2013 Characterization of novel MPS1 inhibitors with preclinical anticancer activity.
23726842 2013 Oncogenic B-Raf(V600E) abrogates the AKT/B-Raf/Mps1 interaction in melanoma cells.
23700430 2013 TTK/hMPS1 is an attractive therapeutic target for triple-negative breast cancer.
23569217 2013 A TPR domain-containing N-terminal module of MPS1 is required for its kinetochore localization by Aurora B.
23531678 2013 UV-C irradiation delays mitotic progression by recruiting Mps1 to kinetochores.
23510141 2013 Universal quantitative kinase assay based on diagonal SCX chromatography and stable isotope dimethyl labeling provides high-definition kinase consensus motifs for PKA and human Mps1.
23388454 2013 VDAC3 and Mps1 negatively regulate ciliogenesis.
23321637 2013 Chk1 and Mps1 jointly regulate correction of merotelic kinetochore attachments.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23067341 2012 Structural and functional insights into the role of the N-terminal Mps1 TPR domain in the SAC (spindle assembly checkpoint).
22935710 2012 VDAC3 regulates centriole assembly by targeting Mps1 to centrosomes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22732840 2012 Mps1 promotes rapid centromere accumulation of Aurora B.
22430208 2013 Phosphorylation of Mps1 by BRAFV600E prevents Mps1 degradation and contributes to chromosome instability in melanoma.
21778823 2011 Two LXXLL motifs in the N terminus of Mps1 are required for Mps1 nuclear import during G(2)/M transition and sustained spindle checkpoint responses.
21587233 2011 Aurora B potentiates Mps1 activation to ensure rapid checkpoint establishment at the onset of mitosis.
21533207 2011 Quantitative mass spectrometry analysis reveals similar substrate consensus motif for human Mps1 kinase and Plk1.
21475725 2011 Targeting the mitotic checkpoint to kill tumor cells.
21402910 2011 High levels of the Mps1 checkpoint protein are protective of aneuploidy in breast cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21163887 2011 High frequency of TTK mutations in microsatellite-unstable colorectal cancer and evaluation of their effect on spindle assembly checkpoint.
20980622 2010 Mps1 phosphorylation sites regulate the function of centrin 2 in centriole assembly.
20937696 2010 Release of Mps1 from kinetochores is crucial for timely anaphase onset.
20884615 2010 Cellular abundance of Mps1 and the role of its carboxyl terminal tail in substrate recruitment.
20861309 2010 Antizyme restrains centrosome amplification by regulating the accumulation of Mps1 at centrosomes.
20729194 2010 Degradation of the human mitotic checkpoint kinase Mps1 is cell cycle-regulated by APC-cCdc20 and APC-cCdh1 ubiquitin ligases.
20624902 2010 Mps1 directs the assembly of Cdc20 inhibitory complexes during interphase and mitosis to control M phase timing and spindle checkpoint signaling.
20624901 2010 Dissecting the role of MPS1 in chromosome biorientation and the spindle checkpoint through the small molecule inhibitor reversine.
20624899 2010 Sustained Mps1 activity is required in mitosis to recruit O-Mad2 to the Mad1-C-Mad2 core complex.
20624898 2010 A chemical tool box defines mitotic and interphase roles for Mps1 kinase.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20422024 2010 Chemical genetic inhibition of Mps1 in stable human cell lines reveals novel aspects of Mps1 function in mitosis.
20100468 2010 Synchronised phosphorylation of BNIP3, Bcl-2 and Bcl-xL in response to microtubule-active drugs is JNK-independent and requires a mitotic kinase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20057968 2009 Mutational analysis of TTK gene in gastric and colorectal cancers with microsatellite instability.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19530738 2009 Phosphorylation of a borealin dimerization domain is required for proper chromosome segregation.
19459850 2009 Vaccination with multiple peptides derived from novel cancer-testis antigens can induce specific T-cell responses and clinical responses in advanced esophageal cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19332559 2009 TTK/hMps1 mediates the p53-dependent postmitotic checkpoint by phosphorylating p53 at Thr18.
19274768 2009 Mps1 as a link between centrosomes and genomic instability.
19273613 2009 Spatiotemporal control of mitosis by the conserved spindle matrix protein Megator.
19151762 2009 The cell cycle checkpoint kinase CHK2 mediates DNA damage-induced stabilization of TTK/hMps1.
19120698 2009 Structural and mechanistic insights into Mps1 kinase activation.
19018011 2008 Holding their own: the noncanonical roles of Smad proteins.
19015317 2008 Phosphorylation sites in BubR1 that regulate kinetochore attachment, tension, and mitotic exit.
18923149 2009 Regulation of kinetochore recruitment of two essential mitotic spindle checkpoint proteins by Mps1 phosphorylation.
18794806 2008 TTK/Mps1 controls nuclear targeting of c-Abl by 14-3-3-coupled phosphorylation in response to oxidative stress.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18680479 2009 Phosphoregulation of human Mps1 kinase.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541701 2008 Mps1 kinase activity restrains anaphase during an unperturbed mitosis and targets Mad2 to kinetochores.
18480048 2008 Crystal structure of the catalytic domain of the mitotic checkpoint kinase Mps1 in complex with SP600125.
18452554 2008 Detection of novel cancer-testis antigen-specific T-cell responses in TIL, regional lymph nodes, and PBL in patients with esophageal squamous cell carcinoma.
18243099 2008 Mps1 phosphorylates Borealin to control Aurora B activity and chromosome alignment.
18083840 2007 Autophosphorylation-dependent activation of human Mps1 is required for the spindle checkpoint.
18071315 2008 B-Raf(V600E) signaling deregulates the mitotic spindle checkpoint through stabilizing Mps1 levels in melanoma cells.
17998396 2007 PRP4 is a spindle assembly checkpoint protein required for MPS1, MAD1, and MAD2 localization to the kinetochores.
17981789 2007 A cell proliferation and chromosomal instability signature in anaplastic thyroid carcinoma.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17804818 2007 Preventing the degradation of mps1 at centrosomes is sufficient to cause centrosome reduplication in human cells.
17784873 2007 Identification of human leukocyte antigen-A24-restricted epitope peptides derived from gene products upregulated in lung and esophageal cancers as novel targets for immunotherapy.
17728254 2007 Mps1 activation loop autophosphorylation enhances kinase activity.
17573779 2007 Physical and functional interaction between mortalin and Mps1 kinase.
17452325 2007 Activation of Mps1 promotes transforming growth factor-beta-independent Smad signaling.
17439397 2007 Targeting cell cycle kinases for cancer therapy.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17268814 2007 Genetic variation in the major mitotic checkpoint genes does not affect familial breast cancer risk.
17210994 2007 Breast cancer risk associated with genotypic polymorphism of the mitotic checkpoint genes: a multigenic study on cancer susceptibility.
16864798 2006 MPS1-dependent mitotic BLM phosphorylation is important for chromosome stability.
16446370 2006 DNA damage-induced expression of p53 suppresses mitotic checkpoint kinase hMps1: the lack of this suppression in p53MUT cells contributes to apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16080195 2006 Analysis of Aurora-A and hMPS1 mitotic kinases in mantle cell lymphoma.
15618221 2005 TTK/hMps1 participates in the regulation of DNA damage checkpoint response by phosphorylating CHK2 on threonine 68.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304323 2004 TTK kinase is essential for the centrosomal localization of TACC2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657364 2003 Human Mps1 protein kinase is required for centrosome duplication and normal mitotic progression.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12686615 2003 Human MPS1 kinase is required for mitotic arrest induced by the loss of CENP-E from kinetochores.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351790 2002 Role of Hec1 in spindle checkpoint signaling and kinetochore recruitment of Mad1/Mad2.
10366450 1999 Characterization of MAD2B and other mitotic spindle checkpoint genes.
7737118 1995 Yeast spindle pole body duplication gene MPS1 encodes an essential dual specificity protein kinase.
7678926 1993 Characterization of a human protein threonine kinase isolated by screening an expression library with antibodies to phosphotyrosine.
1956325 1991 Protein kinase catalytic domain sequence database: identification of conserved features of primary structure and classification of family members.
1639825 1992 Expression of TTK, a novel human protein kinase, is associated with cell proliferation.