Property Summary

Ligand Count 211
NCBI Gene PubMed Count 113
PubMed Score 219.09
PubTator Score 132.46

Knowledge Summary

Patent (42,180)

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma 2.799 8.1e-05
adult high grade glioma 3.100 7.9e-06
Astrocytoma, Pilocytic 1.100 8.3e-04
Atopic dermatitis 2.000 5.3e-05
atypical teratoid / rhabdoid tumor 3.600 2.8e-11
Breast cancer 2.400 2.3e-11
breast carcinoma 1.700 5.1e-34
colon cancer 1.600 2.2e-03
ductal carcinoma in situ 2.200 1.4e-02
Endometriosis 1.524 2.6e-02
ependymoma 2.000 3.7e-07
esophageal adenocarcinoma 1.500 1.8e-02
glioblastoma 3.500 2.0e-11
group 3 medulloblastoma 4.500 2.5e-10
intraductal papillary-mucinous carcinoma... 3.000 2.0e-04
intraductal papillary-mucinous neoplasm ... 3.500 6.1e-04
invasive ductal carcinoma 2.400 1.2e-03
lung adenocarcinoma 1.100 1.4e-06
lung cancer 1.400 2.4e-03
malignant mesothelioma 1.800 4.1e-07
medulloblastoma, large-cell 4.100 2.2e-07
nasopharyngeal carcinoma 1.300 9.1e-04
non primary Sjogren syndrome sicca -1.100 2.3e-02
non-small cell lung cancer 3.455 2.6e-30
ovarian cancer 2.800 6.3e-07
pancreatic cancer 1.400 1.1e-04
primitive neuroectodermal tumor 4.100 3.7e-07
psoriasis 1.100 9.6e-05

PDB (64)

Gene RIF (94)

AA Sequence

MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMANNPEDWLSLLL      1 - 70
KLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELKAIQEPDDARDYFQMARANCK     71 - 140
KFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEMLEIALRNLNLQKKQLLSEEEKKNLSASTVLT    141 - 210
AQESFSGSLGHLQNRNNSCDSRGQTTKARFLYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLN    211 - 280
SPDCDVKTDDSVVPCFMKRQTSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELII    281 - 350
TDSITLKNKTESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ    351 - 420
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQLSTPYGQPAC    421 - 490
FQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA    491 - 560
DNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKN    561 - 630
MLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSS    631 - 700
SRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKC    701 - 770
CLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE    771 - 840
SHNSSSSKTFEKKRGKK                                                         841 - 857
//

Text Mined References (125)

PMID Year Title