Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 2
Funding $797,563.96
PubMed Score 1.35
PubTator Score 3.30

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
25682866 A Golgi-based KDELR-dependent signalling pathway controls invadopodia-dependent extracellular matrix degradation.
25569479 Hrr25 protein kinase directly modifies Elp1 on two sites and we provide evidence that phosphorylation plays a positive role in the tRNA modification

AA Sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLAC      1 - 70
SYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISK     71 - 140
TGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSL    141 - 210
PA                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25682866 2015 A Golgi-based KDELR-dependent signalling pathway controls extracellular matrix degradation.
25569479 2015 Phosphorylation of Elp1 by Hrr25 is required for elongator-dependent tRNA modification in yeast.
25248455 2015 Exploring the genetics of irritable bowel syndrome: a GWA study in the general population and replication in multinational case-control cohorts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...