Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.35
PubTator Score 3.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.75164253929273E-26
breast carcinoma 1614 1.55385090844914E-21
lung adenocarcinoma 2714 2.32031945867716E-11
atypical teratoid / rhabdoid tumor 4369 3.99934111055298E-8
pediatric high grade glioma 2712 5.22549624129992E-8
pilocytic astrocytoma 3086 3.82289316650464E-7
Duchenne muscular dystrophy 602 6.17831358487846E-6
medulloblastoma, large-cell 6234 6.37313172202716E-6
sonic hedgehog group medulloblastoma 1482 1.71758641423313E-5
primitive neuroectodermal tumor 3031 2.5838977864651E-5
ovarian cancer 8492 3.49351681727133E-5
glioblastoma 5572 4.94802179542067E-5
pituitary cancer 1972 5.14541081573294E-5
osteosarcoma 7933 9.50234898505547E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.23022238285301E-4
ductal carcinoma in situ 1745 3.45856500950279E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.76036675051037E-4
inflammatory breast cancer 404 6.28277721204086E-4
astrocytic glioma 2241 0.00266485152666599
psoriasis 6685 0.00420321193977149
ependymoma 2514 0.00474395622342003
oligodendroglioma 2849 0.00527413395264079
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00588815873764778
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0108796207133082
colon cancer 1475 0.0141850596476538
esophageal adenocarcinoma 737 0.0176010007179145
Multiple myeloma 1328 0.0386706680739487
invasive ductal carcinoma 2950 0.0476827120331262
non primary Sjogren syndrome sicca 840 0.0493951960130027
Disease Target Count Z-score Confidence
Cryptorchidism 67 3.385 1.7

Expression

Synonym

Accession P33947 A4D2P4 Q6IPC5 Q96E30
Symbols ELP-1
ERD2.2

Gene

  Ortholog (10)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Fruitfly OMA Inparanoid

 GO Function (1)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
25682866 A Golgi-based KDELR-dependent signalling pathway controls invadopodia-dependent extracellular matrix degradation.
25569479 Hrr25 protein kinase directly modifies Elp1 on two sites and we provide evidence that phosphorylation plays a positive role in the tRNA modification

AA Sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLAC      1 - 70
SYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISK     71 - 140
TGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSL    141 - 210
PA                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25682866 2015 A Golgi-based KDELR-dependent signalling pathway controls extracellular matrix degradation.
25569479 2015 Phosphorylation of Elp1 by Hrr25 is required for elongator-dependent tRNA modification in yeast.
25248455 2015 Exploring the genetics of irritable bowel syndrome: a GWA study in the general population and replication in multinational case-control cohorts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...