Property Summary

NCBI Gene PubMed Count 114
PubMed Score 127.31
PubTator Score 267.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Adrenoleukodystrophy 29 7.819 3.9
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 3.3e-06
glioblastoma 5792 4.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Hypoadrenocorticism, Familial 2

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.3e-06
glioblastoma 1.400 4.3e-05

Protein-protein Interaction (2)

Gene RIF (63)

AA Sequence

MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGVAAAKAGMNRV      1 - 70
FLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDPRAFGWQLLQWLLI     71 - 140
ALPATFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTYYRVSNMDGRLRNPDQSLTEDVVAFAASVAH    141 - 210
LYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELR    211 - 280
YMHSRVVANSEEIAFYGGHEVELALLQRSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVP    281 - 350
IITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVH    351 - 420
EMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVV    421 - 490
ASLNIRVEEGMHLLITGPNGCGKSSLFRILGGLWPTYGGVLYKPPPQRMFYIPQRPYMSVGSLRDQVIYP    491 - 560
DSVEDMQRKGYSEQDLEAILDVVHLHHILQREGGWEAMCDWKDVLSGGEKQRIGMARMFYHRPKYALLDE    561 - 630
CTSAVSIDVEGKIFQAAKDAGIALLSITHRPSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLE    631 - 700
QQLAGIPKMQRRLQELCQILGEAVAPAHVPAPSPQGPGGLQGAST                             701 - 745
//

Text Mined References (119)

PMID Year Title