Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.51
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession P33778 Q4KN36
Symbols H2B.1
H2B/f
H2BFF

Gene

PDB

3X1S   3X1U  

 GO Function (1)

 GO Process (1)

Gene RIF (6)

PMID Text
22174317 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21362548 RNF20-mediated H2B ubiquitination at DSBs plays a critical role in HRR through chromatin remodeling
14657027 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (28)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21362548 2011 Regulation of homologous recombination by RNF20-dependent H2B ubiquitination.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19135898 2009 Purification of proteins associated with specific genomic Loci.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
More...