Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.67
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (8)

AA Sequence

MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (34)

PMID Year Title