Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
R01 Count 2
Funding $74,556.37
PubMed Score 23.26
PubTator Score 25.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.208 0.000
non-small cell lung cancer -1.347 0.000
lung cancer 3.200 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.300 0.000

Synonym

Accession P33764 D3DV51 Q6FGE4
Symbols S100E

Gene

 Grant Application (2)

PDB

1KSO   3NSI   3NSK   3NSL   3NSO  

Gene RIF (7)

PMID Text
21377473 One disulfide bridge is between Cys30 in the N-terminal pseudo-EF-hand and Cys68 in the C-terminal EF-hand (SS1), and another disulfide bridge attaches Cys99 in the C-terminal coil structure to Cys81 in helix IV (SS2).
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19601998 Observational study of gene-disease association. (HuGE Navigator)
18083705 cytoplasmic S100A3 within the cuticular layer is mostly co-localized with the type III isoform of peptidylarginine deiminase (PAD3)
12470658 Purification and characterization of the S100A3 protein from human hair cuticles.
12136135 structure was solved by MIRAS phasing
12045193 crystal structure of S100A3 at 1.7-A resolution

AA Sequence

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV      1 - 70
DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ                                            71 - 101
//

Text Mined References (21)

PMID Year Title
21377473 2011 Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
18083705 2008 Specific citrullination causes assembly of a globular S100A3 homotetramer: a putative Ca2+ modulator matures human hair cuticle.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470658 2002 Characterization of the cysteine-rich calcium-binding S100A3 protein from human hair cuticles.
12136135 2002 Metal-free MIRAS phasing: structure of apo-S100A3.
More...