Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.12
PubTator Score 25.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 5.4e-12
lung carcinoma 2843 2.1e-10
lung adenocarcinoma 2716 4.7e-10
cystic fibrosis 1696 3.9e-05
lung cancer 4740 8.3e-05
Disease Target Count Z-score Confidence
Pilomatrixoma 12 3.298 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.208 3.9e-05
lung adenocarcinoma -1.100 4.7e-10
lung cancer 3.200 8.3e-05
lung carcinoma -1.300 2.1e-10
non-small cell lung cancer -1.347 5.4e-12

Gene RIF (8)

AA Sequence

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV      1 - 70
DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ                                            71 - 101
//

Text Mined References (22)

PMID Year Title