Property Summary

Ligand Count 2
NCBI Gene PubMed Count 170
PubMed Score 2405.56
PubTator Score 1146.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
tuberculosis -2.200 5.4e-08
cutaneous lupus erythematosus 1.200 9.0e-03
interstitial cystitis 1.900 2.9e-03
invasive ductal carcinoma 2.461 5.1e-06
lung carcinoma -2.000 2.3e-20
osteosarcoma 1.835 1.2e-05
ovarian cancer 1.200 3.8e-12
psoriasis 3.100 3.9e-86

Gene RIF (157)

AA Sequence

MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK      1 - 70
KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA     71 - 140
DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT    141 - 210
NHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERL    211 - 280
RRESVRPV                                                                  281 - 288
//

Text Mined References (174)

PMID Year Title