Property Summary

NCBI Gene PubMed Count 160
Grant Count 813
R01 Count 437
Funding $71,875,854.33
PubMed Score 2342.95
PubTator Score 1146.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.009
osteosarcoma 1.835 0.000
tuberculosis -2.200 0.000
interstitial cystitis 1.900 0.003
invasive ductal carcinoma 2.461 0.000
lung carcinoma -2.000 0.000
ovarian cancer 1.200 0.000
psoriasis 3.100 0.000

Synonym

Accession P33681 Q5DTA9 Q5DTB0
Symbols B7
BB1
B7-1
B7.1
LAB7
CD28LG
CD28LG1

Gene

PDB

1I8L   1DR9  

Gene RIF (154)

PMID Text
27065104 Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression
26697986 B7-1 is not induced in podocytes from patients with minimal change disease or focal segmental glomerulosclerosis.
26561569 Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of Vgamma9Vdelta2 T cells in low levels of IL-2.
26409459 analysis of CTLA4-Ig in B7-1-positive diabetic and non-diabetic kidney disease [review]
25963805 In the present study, we investigated the prognostic significance of the expression of three genes in the PD-L1 pathway, including PD-L1, B7.1 and PD-1, in three independent bladder cancer datasets in the Gene Expression Omnibus database.
25862617 Genetic interaction of CD80 and ALOX5AP was observed in systemic lupus erythematosus in Asian populations.
25497975 Five functional polymorphisms of B7/CD28 co-signaling molecules alter susceptibility to colorectal cancer.
25248333 The immobilization of HIV-1 p24 antigen on the micelles upregulates the expression of cell surface markers CD80 and CD86 in human dendritic cells
24981893 Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD80.
24981235 SNP rs1599795 in CD80 3'-UTR, through disrupting the regulatory role of miR-132-3p, miR-212-3p, and miR-361-5p in CD80 expression, contributed to the occurrence of gastric cancer.
More...

AA Sequence

MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK      1 - 70
KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA     71 - 140
DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT    141 - 210
NHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERL    211 - 280
RRESVRPV                                                                  281 - 288
//

Text Mined References (164)

PMID Year Title
27065104 2016 A Potential Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression.
26697986 2016 Any value of podocyte B7-1 as a biomarker in human MCD and FSGS?
26561569 2016 Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of V?9V?2 T cells in low levels of IL-2.
26409459 2016 CTLA4-Ig in B7-1-positive diabetic and non-diabetic kidney disease.
25963805 2015 The prognostic significance of PD-L1 in bladder cancer.
25862617 2016 Genome-wide search followed by replication reveals genetic interaction of CD80 and ALOX5AP associated with systemic lupus erythematosus in Asian populations.
25497975 2015 Five functional polymorphisms of B7/CD28 co-signaling molecules alter susceptibility to colorectal cancer.
24981893 2014 Induction of death receptor CD95 and co-stimulatory molecules CD80 and CD86 by meningococcal capsular polysaccharide-loaded vaccine nanoparticles.
24981235 2014 A functional variant at miR-132-3p, miR-212-3p, and miR-361-5p binding site in CD80 gene alters susceptibility to gastric cancer in a Chinese Han population.
24951814 2014 Priming of CD8 T cells by adenoviral vectors is critically dependent on B7 and dendritic cells but only partially dependent on CD28 ligation on CD8 T cells.
More...