Property Summary

NCBI Gene PubMed Count 27
Grant Count 23
R01 Count 20
Funding $1,839,826.57
PubMed Score 27.38
PubTator Score 30.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
26531156 Results show that Cks1 and Cks2 promoted proliferation and prevented apoptosis of hepatocellular carcinoma HepG2 cells.
25674223 CKS2 is up-regulated in breast cancer and associated with large tumor size, lack expression of progesterone receptor, poor tumor differentiation and survival
24604089 CKS2 mRNA expression was higher in cancer tissue than in corresponding normal tissue. Patients with positive-CKS2 protein expression had a poorer five year survival frequency than patients who did not express CKS2 protein.
23861775 miR-26a and its target CKS2 modulate cell growth and tumorigenesis of papillary thyroid carcinoma.
23301842 CKS2 mRNA and protein expression were increased in esophageal carcinoma. Overexpression of CKS2 was associated with higher grad, regional lymph node invasion, and neoplastic embolus. CKS2 was negatively associated with the p27(kip1) level in the tumor.
23121546 Cks2 may serve as an independent prognostic factor in patients with cholangiocarcinoma, and play a role in the carcinogenesis of cholangiocarcinoma by facilitating cell cycle progression and Bax-mediated mitochondrial caspase-dependent apoptosis.
21948653 Study calculated DeltaCt values of CKS2 and LEPR and found that their differential expression (C-L index) was significantly higher in grade I than in grade II or III meningiomas.
21697511 Overexpression of Cks1 or Cks2 in human mammary epithelial and breast cancer-derived cells, as well as in other cell types, leads to override of the intra-S-phase checkpoint.
21672358 The Cks2 gene may have potential as a biomarker for predicting superficial bladder cancer progression to muscle-invasive cancer.
21617860 CKS2 is one of the gastric cancer-related genes that correlates with biological aggressiveness and poor prognosis of gastric cancer.
More...

AA Sequence

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR      1 - 70
RPLPKDQQK                                                                  71 - 79
//

Text Mined References (30)

PMID Year Title
26531156 2016 Depletion of Cks1 and Cks2 expression compromises cell proliferation and enhance chemotherapy-induced apoptosis in HepG2 cells.
25674223 2014 Expression of cyclin kinase subunit 2 in human breast cancer and its prognostic significance.
24858038 2015 Cks overexpression enhances chemotherapeutic efficacy by overriding DNA damage checkpoints.
24604089 2014 Clinical and biological impact of cyclin-dependent kinase subunit 2 in esophageal squamous cell carcinoma.
23861775 2013 miR-26a and its target CKS2 modulate cell growth and tumorigenesis of papillary thyroid carcinoma.
23301842 Clinical significance of overexpressed cyclin-dependent kinase subunits 1 and 2 in esophageal carcinoma.
23121546 2013 Oncogenic potential of cyclin kinase subunit-2 in cholangiocarcinoma.
21948653 2011 DNA microarray analysis identifies CKS2 and LEPR as potential markers of meningioma recurrence.
21697511 2012 Cyclin-dependent kinase subunit (Cks) 1 or Cks2 overexpression overrides the DNA damage response barrier triggered by activated oncoproteins.
21672358 2011 Cyclin-dependent kinase-associated protein Cks2 is associated with bladder cancer progression.
More...