Property Summary

NCBI Gene PubMed Count 281
Grant Count 56
R01 Count 30
Funding $4,228,876.58
PubMed Score 625.97
PubTator Score 1539.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P33527 A3RJX2 C9JPJ4 O14819 O43333 P78419 Q59GI9 Q9UQ97 Q9UQ99 Q9UQA0
Symbols MRP
ABCC
GS-X
MRP1
ABC29

Gene

PDB

2CBZ   4C3Z  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
799 screening 843 / 0 / 137895 Identification of Molecular Probes that Activate MRP-1
807 screening 10 / 44 / 9478 Identification of Molecular Probes that Activate MRP-1 (Pilot Screen)
844 confirmatory 42 / 0 / 761 Identification of Molecular Probes that Activate MRP-1 - Dose Response

Gene RIF (260)

PMID Text
26715450 Report decreased function MRP1 activity in methotrexate treated rheumatoid arthritis patients.
26600514 the specific COX-2 inhibitor meloxicam can increase the intracellular accumulation of doxorubicin and enhance doxorubicin-induced cytotoxicity in A549 cancer cells by reducing the expression of MRP1 and MRP4.
26395522 The scanning study identified 46 polymorphic variants by screening 30 exons of the ABCC1 gene with adjacent intronic fragments in 190 unrelated Polish individuals. A large fraction of variants represented rare or even completely novel ones.
26108539 Our data suggested that miR-7 mediated small cell lung cancer chemoresistance by repressing MRP1/ABCC1
26092470 MRP1 knockdown down-regulates the deposition of collagen and leads to a reduced hypertrophic scar fibrosis
26031227 Chronic arsenic exposure negatively correlates with the expression of MRP1 in bronchoalveolar lavage cells in patients with lung cancer.
25964055 ILK may have an important role in the progression of NSCLC, possibly through up-regulation of Snail and MRP1.
25885226 MRP1 activity showed no significant change I primary colorectal cancer patients.
25737551 over 90% of bismuth was passively absorbed, conjugated to glutathione, and transported into vesicles by MRP transporter.
25605145 Up-regulation of multidrug resistance-associated protein 1 is associated with multidrug resistance in lung cancer.
More...

AA Sequence

MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPL      1 - 70
NKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLT     71 - 140
FWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSDRSPLFSETIHDPNPCPE    141 - 210
SSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSK    211 - 280
DPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLI    281 - 350
KFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV    351 - 420
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTY    421 - 490
QVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLV    491 - 560
ALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI    561 - 630
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG    631 - 700
HVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSG    701 - 770
GQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV    771 - 840
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQL    841 - 910
QRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIF    911 - 980
LFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHV    981 - 1050
DLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIP   1051 - 1120
PLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYY   1121 - 1190
PSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA   1191 - 1260
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTG   1261 - 1330
AGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVW   1331 - 1400
TSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQS   1401 - 1470
TIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV            1471 - 1531
//

Text Mined References (292)

PMID Year Title
26715450 2015 MDR-1 and MRP-1 activity in peripheral blood leukocytes of rheumatoid arthritis patients.
26600514 2015 Meloxicam increases intracellular accumulation of doxorubicin via downregulation of multidrug resistance-associated protein 1 (MRP1) in A549 cells.
26395522 2015 Genetic variation of the ABC transporter gene ABCC1 (Multidrug resistance protein 1-MRP1) in the Polish population.
26108539 2015 miR-7 modulates chemoresistance of small cell lung cancer by repressing MRP1/ABCC1.
26092470 2015 MRP1 knockdown down-regulates the deposition of collagen and leads to a reduced hypertrophic scar fibrosis.
26031227 2015 MRP1 expression in bronchoalveolar lavage cells in subjects with lung cancer who were chronically exposed to arsenic.
25964055 2015 Integrin-Linked Kinase, Snail and Multidrug Resistance Protein 1: Three concordant players in the progression of non-small cell lung cancer.
25885226 2015 Decreased functional activity of multidrug resistance protein in primary colorectal cancer.
25737551 2015 Glutathione and multidrug resistance protein transporter mediate a self-propelled disposal of bismuth in human cells.
25605145 2014 RNAi-based knockdown of multidrug resistance-associated protein 1 is sufficient to reverse multidrug resistance of human lung cells.
More...