Property Summary

NCBI Gene PubMed Count 18
PubMed Score 23.44

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P33402 A1L4C4 B7ZLT5 GCS-alpha-2
Symbols GC-SA2
GUC1A2

Gene

PANTHER Protein Class (3)

Gene RIF (9)

PMID Text
24669844 The data support a novel regulatory mechanism whereby sGC activity is tuned by distinct domain interactions that either promote or inhibit catalytic activity.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
22426988 The CO binding affinity of soluble guanylate cyclase alpha 2 subunit is threefold greater than that of human soluble guanylate cyclase alpha 1 subunit.
20978832 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948239 The sGC alpha 1observed in OVCAR-3 and MDA-MB-468 cancer cells which correlated well with the sGC activity and a marked increase in cGMP levels upon exposure to the combination of a NO donor and a sGC activator.
19240061 Observational study of gene-disease association. (HuGE Navigator)
15094474 No significant changes were found in sGC subunit mRNAs in people with schizophrenia or in controls.
11752394 Soluble guanylyl cyclase (sGC) is the major cellular receptor for the intercellular messenger nitric oxide (NO) and mediates a wide range of physiological effects through elevation of intracellular cGMP levels

AA Sequence

MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSPAAAAAAAAPAPTPAASAAAA      1 - 70
AATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQVIGYRDAEKNFHNISNRCSYA     71 - 140
DHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEFFNICFHENERVLRAVGGTLQDFFNGFDALLEHI    141 - 210
RTSFGKQATLESPSFLCKELPEGTLMLHYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDV    211 - 280
SNPGNCSCLTFLIKECENTNIMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQL    281 - 350
RCDTHKVLKFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSIL    351 - 420
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKT    421 - 490
VDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFL    491 - 560
DIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVR    561 - 630
MPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVR    631 - 700
TGPKPPKPSLSSSRIKKVSYNIGTMFLRETSL                                          701 - 732
//

Text Mined References (21)

PMID Year Title
25390645 2014 Genome-wide and gene-based association studies of anxiety disorders in European and African American samples.
24669844 2014 Interfacial residues promote an optimal alignment of the catalytic center in human soluble guanylate cyclase: heterodimerization is required but not sufficient for activity.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22426988 2012 Structural and functional insights into the heme-binding domain of the human soluble guanylate cyclase ?2 subunit and heterodimeric ?2?1.
20978832 2011 Gene-environment interaction in the etiology of mathematical ability using SNP sets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19948239 2010 Role of soluble guanylyl cyclase-cyclic GMP signaling in tumor cell proliferation.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...