Property Summary

Ligand Count 5
NCBI Gene PubMed Count 19
PubMed Score 23.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.6
Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 3.691 1.8

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.300 8.4e-03
adult high grade glioma -1.200 3.5e-02
atypical teratoid / rhabdoid tumor -3.000 1.2e-04
Breast cancer 1.800 1.1e-04
ependymoma -1.300 1.9e-02
gastric carcinoma 1.200 2.1e-02
glioblastoma -1.400 1.3e-03
group 3 medulloblastoma -1.800 7.6e-03
intraductal papillary-mucinous adenoma (... -3.300 2.6e-05
intraductal papillary-mucinous carcinoma... -3.500 2.8e-05
intraductal papillary-mucinous neoplasm ... -3.200 1.3e-03
lung adenocarcinoma -1.200 1.5e-14
lung cancer -1.800 3.2e-03
lung carcinoma -1.100 1.2e-09
medulloblastoma, large-cell -1.100 2.2e-02
non primary Sjogren syndrome sicca -1.100 2.2e-02
non-small cell lung cancer -2.082 8.2e-16
osteosarcoma 1.038 2.0e-02
ovarian cancer 1.100 1.7e-02
Pick disease 1.500 1.9e-02
primitive neuroectodermal tumor -1.400 1.5e-02
psoriasis -1.300 1.0e-16
sarcoidosis 1.100 1.5e-02

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSPAAAAAAAAPAPTPAASAAAA      1 - 70
AATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQVIGYRDAEKNFHNISNRCSYA     71 - 140
DHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEFFNICFHENERVLRAVGGTLQDFFNGFDALLEHI    141 - 210
RTSFGKQATLESPSFLCKELPEGTLMLHYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDV    211 - 280
SNPGNCSCLTFLIKECENTNIMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQL    281 - 350
RCDTHKVLKFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSIL    351 - 420
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKT    421 - 490
VDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFL    491 - 560
DIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVR    561 - 630
MPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVR    631 - 700
TGPKPPKPSLSSSRIKKVSYNIGTMFLRETSL                                          701 - 732
//

Text Mined References (22)

PMID Year Title