Property Summary

NCBI Gene PubMed Count 39
Grant Count 44
R01 Count 31
Funding $5,995,805.23
PubMed Score 211.81
PubTator Score 48.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
24311590 Comparison of the cellular distribution of wild-type dUTPase with those of hyperphosphorylation- and hypophosphorylation-mimicking mutants suggests that phosphorylation at Ser11 leads to the exclusion of dUTPase from the nucleus.
23894549 EBV-encoded dUTPase may act as an intercellular signaling molecule capable of modulating the cellular microenvironment
22944692 Positional proteomics analysis identifies the cleavage of human deoxyuridine triphosphatase (DUT) at amino acid residues 231-232 by the HIV-1 protease
22172489 Data sugget that inhibition of dUTPase is a mechanism-based therapeutic approach to significantly enhance the efficacy of thymidylate synthase (TS)-targeted chemotherapeutic agents.
21780905 Repression of dUTPase induced specific expression level increments for thymidylate kinase and thymidine kinase, and also an increased sensitization to 5-fluoro-2'-deoxyuridine and 5-fluoro-uracil.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20560137 High dUTP pyrophosphatase is associated with recurrence in colorectal cancer patients undergoing 5-fluorouracil adjuvant chemotherapy
19968781 nuclear dUTPase may be a good biomarker for predicting prognosis in HCC patients after surgical resection
19879316 significant differences between the human and Plasmodium dUTPases
19403629 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA      1 - 70
STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS     71 - 140
AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE    141 - 210
VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN                                211 - 252
//

Text Mined References (48)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24311590 2013 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23894549 2013 Epstein-Barr virus encoded dUTPase containing exosomes modulate innate and adaptive immune responses in human dendritic cells and peripheral blood mononuclear cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22172489 2012 Inhibition of dUTPase induces synthetic lethality with thymidylate synthase-targeted therapies in non-small cell lung cancer.
21780905 2011 Cellular response to efficient dUTPase RNAi silencing in stable HeLa cell lines perturbs expression levels of genes involved in thymidylate metabolism.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...