Property Summary

Ligand Count 126
NCBI Gene PubMed Count 40
PubMed Score 227.75
PubTator Score 48.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis -1.016 4.4e-02
gastric carcinoma 1.100 2.1e-02
group 3 medulloblastoma 1.600 3.9e-05
intraductal papillary-mucinous carcinoma... 1.100 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.600 4.3e-02
lung cancer 1.100 1.4e-02
malignant mesothelioma 2.000 7.3e-08
Multiple myeloma 1.719 6.7e-04
nasopharyngeal carcinoma 1.100 6.1e-04
osteosarcoma -2.334 9.0e-05
ovarian cancer -1.200 7.3e-05
pancreatic ductal adenocarcinoma liver m... 1.828 4.2e-03
tuberculosis 1.300 6.1e-07
Waldenstrons macroglobulinemia 2.058 3.2e-03

Gene RIF (18)

AA Sequence

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA      1 - 70
STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS     71 - 140
AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE    141 - 210
VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN                                211 - 252
//

Text Mined References (49)

PMID Year Title