Property Summary

NCBI Gene PubMed Count 39
PubMed Score 211.81
PubTator Score 48.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 8.20629017420085E-9
malignant mesothelioma 3163 7.28744405508956E-8
tuberculosis 1563 1.98795581792744E-6
group 3 medulloblastoma 2254 3.9411430802359E-5
osteosarcoma 7933 9.00994427668802E-5
nasopharyngeal carcinoma 1056 6.11718814955914E-4
Multiple myeloma 1328 6.73390888825566E-4
Waldenstrons macroglobulinemia 765 0.0032314270959018
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00416663790479094
lung cancer 4473 0.0143243148132361
gastric carcinoma 832 0.0211344565963025
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.033250449586676
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0431287418681967
active ulcerative colitis 477 0.0438210453704153

Expression

Synonym

Gene

DUT

PANTHER Protein Class (2)

PDB

1Q5H   1Q5U   2HQU   3ARA   3ARN   3EHW   4MZ5   4MZ6  

  Ortholog (1)

Species Source
S.cerevisiae OMA EggNOG

Gene RIF (17)

PMID Text
24311590 Comparison of the cellular distribution of wild-type dUTPase with those of hyperphosphorylation- and hypophosphorylation-mimicking mutants suggests that phosphorylation at Ser11 leads to the exclusion of dUTPase from the nucleus.
23894549 EBV-encoded dUTPase may act as an intercellular signaling molecule capable of modulating the cellular microenvironment
22944692 Positional proteomics analysis identifies the cleavage of human deoxyuridine triphosphatase (DUT) at amino acid residues 231-232 by the HIV-1 protease
22172489 Data sugget that inhibition of dUTPase is a mechanism-based therapeutic approach to significantly enhance the efficacy of thymidylate synthase (TS)-targeted chemotherapeutic agents.
21780905 Repression of dUTPase induced specific expression level increments for thymidylate kinase and thymidine kinase, and also an increased sensitization to 5-fluoro-2'-deoxyuridine and 5-fluoro-uracil.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20560137 High dUTP pyrophosphatase is associated with recurrence in colorectal cancer patients undergoing 5-fluorouracil adjuvant chemotherapy
19968781 nuclear dUTPase may be a good biomarker for predicting prognosis in HCC patients after surgical resection
19879316 significant differences between the human and Plasmodium dUTPases
19403629 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA      1 - 70
STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS     71 - 140
AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE    141 - 210
VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN                                211 - 252
//

Text Mined References (48)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24311590 2013 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23894549 2013 Epstein-Barr virus encoded dUTPase containing exosomes modulate innate and adaptive immune responses in human dendritic cells and peripheral blood mononuclear cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22172489 2012 Inhibition of dUTPase induces synthetic lethality with thymidylate synthase-targeted therapies in non-small cell lung cancer.
21780905 2011 Cellular response to efficient dUTPase RNAi silencing in stable HeLa cell lines perturbs expression levels of genes involved in thymidylate metabolism.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...