Property Summary

NCBI Gene PubMed Count 811
Grant Count 144
R01 Count 54
Funding $18,925,454.46
PubMed Score 1627.43
PubTator Score 2196.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.044

Synonym

Accession P33261 P33259 Q8WZB1 Q8WZB2 Q9UCD4
Symbols CPCJ
CYP2C
P450C2C
CYPIIC17
CYPIIC19
P450IIC19

Gene

PDB

4GQS  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
778 screening 20295 / 0 / 75572 CYP2C19 Assay
899 confirmatory 1964 / 1313 / 7043 qHTS Assay for Inhibitors and Substrates of Cytochrome P450 2C19
1025 screening 1 / 0 / 95866 HTS Assay for Activators of Cytochrome P450 2A19
1851 other 0 / 0 / 0 Cytochrome panel assay with activity outcomes

Gene RIF (870)

PMID Text
27348249 Among patients with minor ischemic stroke or transient ischemic attack, the use of clopidogrel plus aspirin compared with aspirin alone reduced the risk of a new stroke only in the subgroup of patients who were not carriers of the CYP2C19 loss-of-function alleles. These findings support a role of CYP2C19 genotype in the efficacy of this treatment.
27239927 CYP2C19 gene polymorphisms associated with different responses to antiplatelet therapy in patients with coronary artery disease.
27166533 AUC of omeprazole was higher in females while its elimination also took longer compared with males. AUC of omeprazole was significantly higher in Homz PMs indicating that CYP2C19* displayed genetically deficient metabolism in its homozygous state.
27010145 The genotypic polymorphism is effective on the rate of eradication. Eradication treatment rate with rabeprazole is influenced by CYP2C19 genotype.
26970786 Increased CYP2C19 activity could slightly ameliorate mineralocorticoid deficiency in 21-hydroxylase Deficiency.
26916483 CYP2C19 metabolizer status is not associated with the composite outcome of cardiovascular death, MI, or stroke in medically managed ACS patients treated with clopidogrel or prasugrel.
26822491 no evidence was found that CYP2C19 polymorphisms are associated with susceptibility to primary open-angle glaucoma.
26817099 High frequency of CYP2C19 ultrarapid metabolizers in Russian patients with peptic ulcer may be associated with insufficient response to proton pump inhibitors.
26722519 Our results shed new light on CYP2C19 polymorphisms in Li individuals
26690534 In the title.
More...

AA Sequence

MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFG      1 - 70
LERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRS     71 - 140
IEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVST    141 - 210
PWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQS    211 - 280
EFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDA    281 - 350
VVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK    351 - 420
KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV    421 - 490
//

Text Mined References (813)

PMID Year Title
27348249 2016 Association Between CYP2C19 Loss-of-Function Allele Status and Efficacy of Clopidogrel for Risk Reduction Among Patients With Minor Stroke or Transient Ischemic Attack.
27239927 2016 [The possibility of selecting optimal antiplatelet therapy in patients with coronary heart disease in terms of CYP2C19 polymorphism].
27166533 2016 Variation in pharmacokinetics of omeprazole and its metabolites by gender and CYP2C19 genotype in Pakistani male and female subjects.
27010145 2016 Effect of cytochrome P450 2C19 polymorphisms on the Helicobacter pylori eradication rate following two-week triple therapy with pantoprazole or rabeprazole.
26970786 2016 Clinical Role of CYP2C19 Polymorphisms in Patients with Congenital Adrenal Hyperplasia Due to 21-hydroxylase Deficiency.
26916483 2016 Impact of CYP2C19 Metabolizer Status on Patients With ACS Treated With Prasugrel Versus Clopidogrel.
26822491 2016 Roles of CYP2C19 Gene Polymorphisms in Susceptibility to POAG and Individual Differences in Drug Treatment Response.
26817099 2015 [HIGH FREQUENCY OF CYP2C19 ULTRARAPID METABOLIZERS IN RUSSIAN PATIENTS WITH PEPTIC ULCER].
26722519 2015 Genetic polymorphisms and phenotypic analysis of drug-metabolizing enzyme CYP2C19 in a Li Chinese population.
26690534 2015 Characterization of drug-metabolizing enzymes CYP2C9, CYP2C19 polymorphisms in Tunisian, Kuwaiti and Bahraini populations.
More...