Property Summary

NCBI Gene PubMed Count 40
Grant Count 115
R01 Count 38
Funding $15,425,294.73
PubMed Score 151.47
PubTator Score 97.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P33260 B2R8K2 Q16703 Q16751 Q4VAT5 Q6GRG1
Symbols CPCI
CYP2C
CYP2C17
P450IIC17
P450-6B/29C

Gene

PDB

2CIK   2H6P  

Gene RIF (14)

PMID Text
21798861 These results suggest that there is no notable influence of sequence variation in the CYP2C genes on longevity in the examined German population
20529763 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20045989 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19706858 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19578179 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFG      1 - 70
LKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRS     71 - 140
IEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSS    141 - 210
PWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQS    211 - 280
EFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDA    281 - 350
VVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK    351 - 420
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV    421 - 490
//

Text Mined References (42)

PMID Year Title
23755828 2013 Genetic variants associated with warfarin dose in African-American individuals: a genome-wide association study.
21798861 2011 Genetic variation in the CYP2C monooxygenase enzyme subfamily shows no association with longevity in a German population.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20045989 2009 Influence of the genetic polymorphisms in the 5' flanking and exonic regions of CYP2C19 on proguanil oxidation.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19706858 2009 Association of cytochrome P450 2C19 genotype with the antiplatelet effect and clinical efficacy of clopidogrel therapy.
19578179 2009 A genome-wide association study of acenocoumarol maintenance dosage.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
More...