Property Summary

NCBI Gene PubMed Count 59
Grant Count 18
R01 Count 7
Funding $1,379,371.63
PubMed Score 76.88
PubTator Score 72.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.100 0.001
osteosarcoma -1.319 0.023
lung cancer -1.400 0.002
fibroadenoma -1.500 0.003
pilocytic astrocytoma 1.200 0.005
COPD -1.100 0.004
cystic fibrosis and chronic rhinosinusit... 1.073 0.024

Gene RIF (36)

PMID Text
26554018 the importance of LSP1 Copy number variations and LSP1 insufficiency in the pathogenesis of rheumatoid arthritis, is reported.
26191300 LSP1 rs569550 and rs592373 polymorphisms are both risk factors for breast cancer.
24681604 The breast cancer SNP LSP1 rs3817198 was associated with an increased risk of lung cancer (odds ratio: 1.10) This association was strongest for women with adenocarcinoma (P = 1.2x10(-4)).
24162774 HIV-1 gp120 upregulates the expression of lymphocyte-specific protein 1 (LSP1) in human B cells
23119100 Data indicate that slit2N alters the localization and binding of Robo1 to WASp and LSP1 in HIV-1-gp120-treated immature dendritic cells (iDCs).
23119100 HIV-1 gp120 upregulates the expression of lymphocyte-specific protein 1 (LSP1) in human B cells
23119100 HIV-1 gp120 upregulates the expression of lymphocyte-specific protein 1 (LSP1) in human B cells
22454379 Single nucleotide polymorphism in LSP1 is associated with breast cancer.
21127985 The LSP1 rs3817198T>C polymorphism is a low-penetrant risk factor for developing breast cancer but may not be in Africans.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPS      1 - 70
EAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSL     71 - 140
SKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIE    141 - 210
KSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKT    211 - 280
PSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP               281 - 339
//

Text Mined References (66)

PMID Year Title
26554018 2015 Leukocyte-specific protein 1 regulates T-cell migration in rheumatoid arthritis.
26191300 2015 Correlation between LSP1 polymorphisms and the susceptibility to breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
24681604 2014 Pleiotropic associations of risk variants identified for other cancers with lung cancer risk: the PAGE and TRICL consortia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...