Property Summary

NCBI Gene PubMed Count 60
PubMed Score 81.12
PubTator Score 72.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.4e-03
COPD -1.100 3.5e-03
cystic fibrosis and chronic rhinosinusit... 1.073 2.4e-02
fibroadenoma -1.500 3.0e-03
lung cancer -1.400 2.3e-03
osteosarcoma -1.319 2.3e-02
psoriasis -1.100 9.5e-06

Gene RIF (36)

AA Sequence

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPS      1 - 70
EAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSL     71 - 140
SKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIE    141 - 210
KSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKT    211 - 280
PSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP               281 - 339
//

Text Mined References (67)

PMID Year Title