Property Summary

NCBI Gene PubMed Count 48
PubMed Score 46.92
PubTator Score 42.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (14)

AA Sequence

MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA      1 - 70
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM     71 - 140
FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG    141 - 210
AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA    211 - 280
QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP    281 - 350
HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM    351 - 420
EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM    421 - 490
GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR    491 - 560
QSILILKEQIQKSTGAP                                                         561 - 577
//

Text Mined References (59)

PMID Year Title