Property Summary

NCBI Gene PubMed Count 46
Grant Count 45
R01 Count 42
Funding $4,831,029.56
PubMed Score 48.36
PubTator Score 42.84

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (13)

PMID Text
26496945 CstF-64 is dispensable for the expression/3'-end processing of Star-PAP target mRNAs.CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding poly A polymerase.
25409906 CstF64, an essential polyadenylation factor, is a master regulator of 3'-UTR shortening across multiple tumour types.
25266659 CstF64 is central to the function of a heat-labile factor, composed of cleavage/polyadenylation specificity factor, symplekin, and cleavage stimulation factor 64 and appears to be at least partly responsible for its cell cycle regulation.
24149845 CstF64 and CstF64tau modulate one another's expression and play overlapping as well as distinct roles in regulating global alternative polyadenylation profiles.
23112178 CstF64 binds to thousands of dormant intronic PASs that are suppressed, at least in part, by U1 small nuclear ribonucleoproteins
22174317 HIV-1 Rev interacting protein, cleavage stimulation factor, subunit 2 (CSTF2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with CSTF2 is increased by RRE
21813631 CSTF2 is likely to play an important role in lung carcinogenesis and be a prognostic biomarker in the clinic.
21119002 nuclear accumulation of CstF-64 depends on binding to CstF-77 not symplekin; interaction between CstF-64/CstF-64Tau and CstF-77 are important for maintenance of nuclear levels of CstF complex components and intracellular localization, stability, function
19887456 The Hinge domain is necessary for CstF-64 interaction with CstF-77 and consequent nuclear localization.
18272196 The inactivity of the RSV poly(A) site was at least in part due to poor CstF binding since tethering CstF to the RSV substrate activated polyadenylation.
More...

AA Sequence

MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA      1 - 70
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM     71 - 140
FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG    141 - 210
AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA    211 - 280
QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP    281 - 350
HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM    351 - 420
EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM    421 - 490
GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR    491 - 560
QSILILKEQIQKSTGAP                                                         561 - 577
//

Text Mined References (56)

PMID Year Title
26496945 2016 CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding PAP?.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25409906 2014 Dynamic analyses of alternative polyadenylation from RNA-seq reveal a 3'-UTR landscape across seven tumour types.
25266659 2014 CstF64: cell cycle regulation and functional role in 3' end processing of replication-dependent histone mRNAs.
24149845 2013 Overlapping and distinct functions of CstF64 and CstF64? in mammalian mRNA 3' processing.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23112178 2012 Transcriptome-wide analyses of CstF64-RNA interactions in global regulation of mRNA alternative polyadenylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...