Property Summary

NCBI Gene PubMed Count 204
PubMed Score 896.78
PubTator Score 619.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (18)

Disease log2 FC p
ductal carcinoma in situ -1.300 7.1e-04
group 4 medulloblastoma -1.700 1.1e-04
interstitial cystitis 1.700 1.1e-04
intraductal papillary-mucinous adenoma (... -1.200 1.6e-03
intraductal papillary-mucinous carcinoma... -1.300 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.2e-02
invasive ductal carcinoma -1.900 3.7e-04
juvenile dermatomyositis 1.148 7.3e-06
lung adenocarcinoma -2.100 8.7e-18
lung cancer -1.300 5.9e-03
lung carcinoma -2.300 2.5e-13
medulloblastoma, large-cell -1.500 9.8e-05
nephrosclerosis 1.337 1.1e-04
non-small cell lung cancer -2.526 1.8e-22
osteosarcoma -1.857 4.4e-02
psoriasis -1.700 1.0e-03
ulcerative colitis 1.400 1.9e-03
urothelial carcinoma 1.900 1.4e-05

Gene RIF (177)

AA Sequence

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGK      1 - 70
IKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIK     71 - 140
VHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIIT    141 - 210
ITKSLDREKQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSL    211 - 280
FVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMS    281 - 350
PPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR    351 - 420
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFAKPYQPKVCEN    421 - 490
AVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDN    491 - 560
GMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARA    561 - 630
HGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHG    631 - 700
GPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKML    701 - 770
AELYGSDPREELLY                                                            771 - 784
//

Text Mined References (207)

PMID Year Title