Property Summary

NCBI Gene PubMed Count 179
Grant Count 461
R01 Count 310
Funding $43,450,316.74
PubMed Score 812.50
PubTator Score 619.11

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P33151 Q4VAI5 Q4VAI6
Symbols 7B4
CD144

Gene

PANTHER Protein Class (2)

Gene RIF (155)

PMID Text
26921435 S-nitrosylation regulates endothelial cell VE-cadherin phosphorylation and internalization in microvascular permeability.
26728385 Data indicate that monoclonal antibody (mAb) against vascular endothelial cadherin 5 (VECDH5) has good binding ability and specificity.
26681130 Prophylactic UTI maintains the endothelial barrier function, increases VE-cadherin expression, and inhibits the phosphorylation of VE-cadherin at Tyr658 under inflammatory conditions
26663395 Rab11a/Rab11 family-interacting protein 2-mediated VE-cadherin recycling is required for formation of adherens junctions and restoration of vascular endothelial barrier integrity.
26598555 BMP-dependent physical interaction of VE-cadherin with the BMP receptor ALK2 (BMPRI) and BMPRII, resulting in stabilization of the BMP receptor complex and, thereby, the support of BMP6-Smad signaling.
26574545 ankyrin-G associates with and inhibits the endocytosis of VE-cadherin cis dimers.
26116572 our data show the importance of spatio-temporal regulation of the actin cytoskeleton through Trio and Rac1 at VE-cadherin-based cell-cell junctions in the maintenance of the endothelial barrier.
25869066 Girdin regulates the trafficking of VE-cadherin in synergy with R-Ras.
25800053 the transmembrane domain of VE-cadherin mediates an essential adapter function by binding directly to the transmembrane domain of VEGFR2, as well as VEGFR3.
25746323 MRTF-A and p300 activated the transcription of VE-cadherin gene by enhancing acetylation of histones.
More...

AA Sequence

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGK      1 - 70
IKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIK     71 - 140
VHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIIT    141 - 210
ITKSLDREKQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSL    211 - 280
FVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMS    281 - 350
PPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR    351 - 420
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFAKPYQPKVCEN    421 - 490
AVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDN    491 - 560
GMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARA    561 - 630
HGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHG    631 - 700
GPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKML    701 - 770
AELYGSDPREELLY                                                            771 - 784
//

Text Mined References (182)

PMID Year Title
26921435 2016 S-nitrosylation regulates VE-cadherin phosphorylation and internalization in microvascular permeability.
26728385 2016 [Preparation and application of monoclonal antibody against human vascular endothelial cadherin 5].
26681130 2016 Urinary trypsin inhibitor attenuates LPS-induced endothelial barrier dysfunction by upregulation of vascular endothelial-cadherin expression.
26663395 2016 Rab11a Mediates Vascular Endothelial-Cadherin Recycling and Controls Endothelial Barrier Function.
26598555 2016 VE-cadherin facilitates BMP-induced endothelial cell permeability and signaling.
26574545 2016 Ankyrin-G Inhibits Endocytosis of Cadherin Dimers.
26116572 2015 A local VE-cadherin and Trio-based signaling complex stabilizes endothelial junctions through Rac1.
25869066 2015 Girdin/GIV regulates transendothelial permeability by controlling VE-cadherin trafficking through the small GTPase, R-Ras.
25800053 2015 Intramembrane binding of VE-cadherin to VEGFR2 and VEGFR3 assembles the endothelial mechanosensory complex.
25746323 2015 Histone acetyltransferase p300 promotes MRTF-A-mediates transactivation of VE-cadherin gene in human umbilical vein endothelial cells.
More...