Property Summary

NCBI Gene PubMed Count 33
Grant Count 73
R01 Count 54
Funding $15,258,516.26
PubMed Score 365.58
PubTator Score 97.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P33121 B7Z452 D3DP57 P41215 Q8N8V7 Q8TA99
Symbols ACS1
LACS
FACL1
FACL2
LACS1
LACS2

Gene

PANTHER Protein Class (1)

Gene RIF (12)

PMID Text
26728456 SRE motif in ACSL1 is essential for SREBP2-mediated activation of C-ACSL1 gene transcription.
25915184 ACSL1 is a programmable mediator of insulin sensitivity and cellular lipid content.
24503477 the cell surface protein CD36/FAT directly facilitates fatty acid transport across the plasma membrane, whereas the intracellular acyl-CoA synthetases FATP4 and ACSL1 enhance fatty acid uptake indirectly by metabolic trapping
24462768 Data indicate that expression of miR-205 is negatively related to that of ACSL1 in clinical hepatocellular carcinoma (HCC) tissues.
23433401 long-chain acyl-CoA synthetase 1 has a role in eicosapentaenoic acid suppression of palmitate-induced cytokine production
23303383 INSR rs1366600, ACSL1 rs2292899 and FABP2 rs11724758 could influence the susceptibility to type 2 diabetes in Chinese Han population, most likely through their effects on the specific miRNA-binding sites.
22829935 Findings suggest that the ACSL1 gene polymorphism rs6552828 is not associated with elite endurance athletic status in Caucasians, yet a marginal association seems to exist for the Chinese (Han) male population.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20176858 Data show that ACSL1 rs9997745 polymorphism influences metabolic syndrome risk, most likely via disturbances in fatty acid metabolism, which was modulated by dietary fat consumption, particularly PUFA intake, suggesting novel gene-nutrient interactions.
20176858 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGA      1 - 70
RRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQK     71 - 140
GFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLL    141 - 210
EGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTT    211 - 280
GNPKGAMVTHRNIVSDCSAFVKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRL    281 - 350
LMDDLKVLQPTVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV    351 - 420
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIK    421 - 490
LVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIF    491 - 560
KLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDV    561 - 630
KKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV      631 - 698
//

Text Mined References (37)

PMID Year Title
26728456 2016 SREBP2 Activation Induces Hepatic Long-chain Acyl-CoA Synthetase 1 (ACSL1) Expression in Vivo and in Vitro through a Sterol Regulatory Element (SRE) Motif of the ACSL1 C-promoter.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915184 2015 ACSL1 Is Associated With Fetal Programming of Insulin Sensitivity and Cellular Lipid Content.
24503477 2014 Protein mediated fatty acid uptake: synergy between CD36/FAT-facilitated transport and acyl-CoA synthetase-driven metabolism.
24462768 2014 MiR-205 modulates abnormal lipid metabolism of hepatoma cells via targeting acyl-CoA synthetase long-chain family member 1 (ACSL1) mRNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23433401 2013 Eicosapentaenoic acid suppresses palmitate-induced cytokine production by modulating long-chain acyl-CoA synthetase 1 expression in human THP-1 macrophages.
23303383 2013 Single-nucleotide polymorphisms inside microRNA target sites influence the susceptibility to type 2 diabetes.
22829935 2012 Acyl coenzyme A synthetase long-chain 1 (ACSL1) gene polymorphism (rs6552828) and elite endurance athletic status: a replication study.
22022213 2011 Overexpression of CD36 and acyl-CoA synthetases FATP2, FATP4 and ACSL1 increases fatty acid uptake in human hepatoma cells.
More...