Property Summary

NCBI Gene PubMed Count 177
Grant Count 234
R01 Count 133
Funding $22,392,726.23
PubMed Score 496.43
PubTator Score 393.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.100 0.005
osteosarcoma -3.814 0.000
tuberculosis and treatment for 3 months 1.300 0.000
lung cancer -3.400 0.000
active Crohn's disease 1.856 0.007
active ulcerative colitis 1.105 0.046
breast carcinoma 1.100 0.000
interstitial cystitis 1.400 0.001
primary Sjogren syndrome 1.200 0.005
ovarian cancer 1.200 0.000

Synonym

Accession P33076 A0N0N9 D3DUG0 E9PFE0 Q29675 Q8SNB8 Q96KL4 CIITA
Symbols C2TA
NLRA
MHC2TA
CIITAIV

Gene

 GO Component (2)

 GWAS Trait (1)

Gene RIF (182)

PMID Text
27089879 CIITA acts as a general restriction factor against HIV-1 not only in T cells but also in myeloid cells.
26871568 CIITA Isoform III interacts more efficiently with components of the transcription machinery and MHC-II promoter binding proteins.
26792751 Thus, CIITA inhibits cytoplasmic and nuclear steps of human T cell lymphotropic virus type 1 Tax-1-mediated NF-kappaB activation.
26653871 The dimerization region of Epstein-Barr virus Zta is not required to mediate host CIITA repression.
26549456 CIITA gene alterations are a common mechanism of immune escape through reduction of MHC class II expression in primary mediastinal large B cell lymphoma.
26500140 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74.
26283540 two DNA-binding proteins, which interact with and regulate PRC2 recruitment to CIITA promoter IV, were identified.
26181363 Lys(63) ubiquitinated CIITA is concentrated in the cytoplasm and following activation of ERK1/2, CIITA phosphorylation occurs and Lys=ubiquitinated CIITA translocates to the nucleus.
26049756 Genomic alterations underlying immune privilege in malignant lymphomas prominently include structural genomic changes of the CIITA and CD274 loci. (Review)
25992516 We observed that the CIITA polymorphism rs4774 (+1614G/C) in combination with HLA-DRB1*15:01 increased the OR to 2.65 (p = 0.005). Females carrying both the rs4774*C and DRB1*15:01 alleles had an OR of 4.55 (p = 0.02).
More...

AA Sequence

MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEEEIELYSEPDT      1 - 70
DTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFKHIGPDEVIGESMEMPAEVGQ     71 - 140
KSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPM    141 - 210
PFSSSSLSCLNLPEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTS    211 - 280
PDRPGSTSPFAPSATDLPSMPEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYG    281 - 350
AEPAGPDGILVEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG    351 - 420
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAADEVFSHILKR    421 - 490
PDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRGCTLLLTARPRGRLVQSLSKA    491 - 560
DALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRDRPLLLSHSHSPTLCRAVCQLSEALLELGED    561 - 630
AKLPSTLTGLYVGLLGRAALDSPPGALAELAKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPR    631 - 700
AAESELAFPSFLLQCFLGALWLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCL    701 - 770
GALLGPSAAASVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL    771 - 840
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQQHGETKLLQA    841 - 910
AEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKLEFALGPVSGPQAFPKLVRIL    911 - 980
TAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLS    981 - 1050
LYNNCICDVGAESLARVLPDMVSLRVMDVQYNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHL   1051 - 1120
QQQDSRISLR                                                               1121 - 1130
//

Text Mined References (180)

PMID Year Title
27089879 2016 The MHC-II transactivator CIITA inhibits Tat function and HIV-1 replication in human myeloid cells.
26871568 2016 Degradation, Promoter Recruitment and Transactivation Mediated by the Extreme N-Terminus of MHC Class II Transactivator CIITA Isoform III.
26792751 2016 The Major Histocompatibility Complex Class II Transactivator CIITA Inhibits the Persistent Activation of NF-?B by the Human T Cell Lymphotropic Virus Type 1 Tax-1 Oncoprotein.
26653871 2016 Repression of CIITA by the Epstein-Barr virus transcription factor Zta is independent of its dimerization and DNA binding.
26549456 2015 Genomic Alterations in CIITA Are Frequent in Primary Mediastinal Large B Cell Lymphoma and Are Associated with Diminished MHC Class II Expression.
26500140 2016 FOXP1 suppresses immune response signatures and MHC class II expression in activated B-cell-like diffuse large B-cell lymphomas.
26283540 2015 Polycomb recruitment at the Class II transactivator gene.
26181363 2015 The class II transactivator (CIITA) is regulated by post-translational modification cross-talk between ERK1/2 phosphorylation, mono-ubiquitination and Lys63 ubiquitination.
26049756 2015 Genomic alterations underlying immune privilege in malignant lymphomas.
25992516 2015 The CIITA genetic polymorphism rs4774*C in combination with the HLA-DRB1*15:01 allele as a putative susceptibility factor to multiple sclerosis in Brazilian females.
More...