Property Summary

NCBI Gene PubMed Count 185
PubMed Score 506.83
PubTator Score 393.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 1.2
Disease Target Count Z-score Confidence
MHC class II deficiency 6 0.0 5.0
Disease Target Count Z-score Confidence
Severe combined immunodeficiency 51 4.233 2.1
Disease Target Count Z-score Confidence
Cancer 2499 3.6 1.8
Addison's disease 31 3.316 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.856 7.0e-03
active ulcerative colitis 1.105 4.6e-02
breast carcinoma 1.100 3.1e-04
interstitial cystitis 1.400 6.6e-04
lung cancer -2.500 6.4e-04
osteosarcoma -3.814 1.6e-07
ovarian cancer 1.200 4.8e-08
primary Sjogren syndrome 1.200 5.4e-03
psoriasis -1.100 5.3e-03
tuberculosis 1.200 1.6e-04

 GO Component (2)

Gene RIF (184)

AA Sequence

MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEEEIELYSEPDT      1 - 70
DTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFKHIGPDEVIGESMEMPAEVGQ     71 - 140
KSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPM    141 - 210
PFSSSSLSCLNLPEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTS    211 - 280
PDRPGSTSPFAPSATDLPSMPEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYG    281 - 350
AEPAGPDGILVEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG    351 - 420
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAADEVFSHILKR    421 - 490
PDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRGCTLLLTARPRGRLVQSLSKA    491 - 560
DALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRDRPLLLSHSHSPTLCRAVCQLSEALLELGED    561 - 630
AKLPSTLTGLYVGLLGRAALDSPPGALAELAKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPR    631 - 700
AAESELAFPSFLLQCFLGALWLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCL    701 - 770
GALLGPSAAASVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL    771 - 840
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQQHGETKLLQA    841 - 910
AEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKLEFALGPVSGPQAFPKLVRIL    911 - 980
TAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLS    981 - 1050
LYNNCICDVGAESLARVLPDMVSLRVMDVQYNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHL   1051 - 1120
QQQDSRISLR                                                               1121 - 1130
//

Text Mined References (188)

PMID Year Title